Shewanella mangrovisoli: K0H60_02015 Help Entry K0H60_02015       CDS       T09316                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism smay  Shewanella mangrovisoli Pathway smay01100   Metabolic pathways smay01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:smay00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     K0H60_02015    00074 Mycolic acid biosynthesis     K0H60_02015   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     K0H60_02015 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QYK09501 LinkDB All DBs Position complement(431933..432187) Genome browser AA seq 84 aa AA seqDB search MTLHNEIKQLIIDCLDLEDVSIDDIDTDAPLFGEGLGLDSIDALELGLAIKKKFDVKIEA NSDSTKAHFYSVASLANFIESQRP NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgactttacataacgaaattaaacagttgatcatcgactgcctcgacttagaagacgtc agtattgatgatatcgacacagatgcaccgctctttggtgagggacttggactcgactcg atcgacgcgctcgagctgggtttagccatcaagaaaaaatttgatgtgaaaatcgaagcc aactcggatagcactaaggcgcatttttacagcgtcgccagcctagctaacttcatcgaa tcacaacgtccgtag

DBGET integrated database retrieval system