Streptococcus mitis: smi_0054 Help Entry smi_0054          CDS       T01173                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism smb  Streptococcus mitis Pathway smb01100   Metabolic pathways smb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:smb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     smi_0054 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     smi_0054 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF6315 DUF1493 Motif Other DBs NCBI-ProteinID:  CBJ21351 UniProt:  D3H661 LinkDB All DBs Position 53621..53854 Genome browser AA seq 77 aa AA seqDB search MTEKEIFDRIVTIIQERQGEDFVVTESLSLKDDLDADSVDLMEFILTLEDEFSIEISDEE IDQLQSVGDVVKIIQAK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgacagaaaaagaaatttttgaccgtattgtgaccattatccaagagcgacagggagag gactttgtcgtgacagaatccttgagtctgaaagacgatttggatgctgactcagttgac ttaatggagtttatcttgacgctggaagatgaatttagtatcgaaatcagcgatgaggaa attgaccaactgcaaagtgtaggagatgtggttaaaatcattcaagcaaaataa

DBGET integrated database retrieval system