Sinorhizobium medicae: Smed_4238
Help
Entry
Smed_4238 CDS
T00555
Name
(GenBank) Carbamoyl-phosphate synthase L chain ATP-binding
KO
K01965
propionyl-CoA carboxylase alpha subunit [EC:
6.4.1.3
]
Organism
smd
Sinorhizobium medicae
Pathway
smd00280
Valine, leucine and isoleucine degradation
smd00630
Glyoxylate and dicarboxylate metabolism
smd00640
Propanoate metabolism
smd01100
Metabolic pathways
smd01110
Biosynthesis of secondary metabolites
smd01120
Microbial metabolism in diverse environments
smd01200
Carbon metabolism
Module
smd_M00741
Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:
smd00001
]
09100 Metabolism
09101 Carbohydrate metabolism
00630 Glyoxylate and dicarboxylate metabolism
Smed_4238
00640 Propanoate metabolism
Smed_4238
09105 Amino acid metabolism
00280 Valine, leucine and isoleucine degradation
Smed_4238
Enzymes [BR:
smd01000
]
6. Ligases
6.4 Forming carbon-carbon bonds
6.4.1 Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
6.4.1.3 propionyl-CoA carboxylase
Smed_4238
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CPSase_L_D2
Biotin_carb_N
Biotin_carb_C
PCC_BT
Biotin_lipoyl
Dala_Dala_lig_C
ATP-grasp
RimK
ATPgrasp_ST
Biotin_lipoyl_2
GARS_A
ATP-grasp_5
HlyD_3
ATP-grasp_3
RPOC_hybrid
DUF2118
Motif
Other DBs
NCBI-ProteinID:
ABR63043
UniProt:
A6UHB3
LinkDB
All DBs
Position
pSMED01:complement(721133..723145)
Genome browser
AA seq
670 aa
AA seq
DB search
MENMFKKILIANRGEIACRVIRTAKSLDIPTVAVYSDADRDAMHVRMADEAVPIGPSPSN
QSYIVIDRILEAIRKTGADAVHPGYGFLSENSAFAEALEKEGVTFIGPPVRAIEAMGDKI
TSKKLAAEAGVSTVPGHMGLIGDADEAARIAASIGFPVMIKASAGGGGKGMRIAWTEDEA
REGFQSSKNEAKSSFGDDRIFIEKFVTEPRHIEIQVLGDKHGNIVYLGERECSIQRRNQK
VIEEAPSPFLDEKTRRAMGEQAVALAKAVAYFSAGTVEFIVDARGNFYFLEMNTRLQVEH
PVTELVTGLDLVEQMIRVAAGEKLAFAQKDVKLDGWAIESRLYAEDPYRNFLPSIGRLSR
YRPPEEGPRADGTVIRNDTGVLEGGEISMYYDPMIAKLCTWGPDRATAVRAMADALDAFE
IEGVGHNLPFLAAVMQQDRFREGRLTTAYIAEEFAGGFQGVVPDDTAARKLAAIAVSVNQ
TLQERASRISGTIGNHRRVIGHEWVASLDGHEIQVTCEASADGTYVRFADGTSVSVATDW
TPGRTRAAFNIENQPMSVKVELAGTGIRLRWRGIDVVARVRSPHIAELARLMPKKLPPDT
SKMLLCPMPGVVTSITVKAGETVEAGQAIAVVEAMKMENILRAERRSIVKRVAIEAGASL
AVDELIMEFE
NT seq
2013 nt
NT seq
+upstream
nt +downstream
nt
atggaaaacatgttcaagaaaatcctcattgccaatcgtggtgaaatcgcctgccgcgtc
atccgcacagcgaagtctctcgacatcccgaccgtcgccgtctactcggatgcggaccgc
gacgcgatgcatgtgcgcatggcggacgaggccgttcctatcggcccctcaccctcaaac
cagtcctatatcgtcatagacaggattcttgaggcaatccgcaagaccggcgccgatgcg
gtgcatcctggctacggcttcctttctgaaaattccgccttcgccgaggctctggagaaa
gagggcgtaaccttcatcggtccgccagtcagggccatcgaagcgatgggcgacaagatc
acctcgaagaagcttgccgccgaagcaggcgtttccaccgttcccggccatatggggctg
atcggggatgcggacgaggccgcacgcatcgccgcttcgatcggctttccggtgatgata
aaggcgtctgccggcggcggcggcaagggaatgcggatcgcctggaccgaggacgaggca
cgcgagggctttcagtcatcgaagaacgaggcgaagagttccttcggcgacgaccgcatc
ttcatcgagaaattcgtgaccgagccccgccacatcgagatccaggtgctcggcgacaag
catggcaacatcgtctatctgggcgagcgcgaatgctcgatccagcggcggaaccagaag
gttatcgaggaggcgccctcgcccttcctcgacgagaagacgcgccgcgccatgggcgag
caggcggtggcgctggcaaaggccgtcgcctatttttcggccggcacggtcgagttcatc
gtcgacgcccgcggaaacttctattttctcgagatgaatacccggctgcaggtcgagcat
ccggtgacggaactcgtcaccggcctcgatctcgtcgagcagatgatccgcgtcgcggcg
ggggagaaactcgcctttgcacagaaggatgtgaagctcgacggatgggcgatcgaaagc
cggctctatgcggaagacccctaccgcaattttcttccttcgatcggccggctgagccgc
taccgcccgccggaggaaggcccgcgggcggacggtaccgtcattcgcaacgataccggc
gtcttggaaggcggcgagatctcgatgtattacgatccgatgatcgccaagctttgcacc
tggggtccggaccgggcgaccgccgtccgggcgatggcggatgcgctcgacgcgttcgag
atcgaaggcgtcggccacaacctgcccttccttgcagccgtcatgcagcaggatcgtttc
cgcgagggacggctgaccacggcctatatcgccgaggagtttgccggcggttttcagggc
gtggtgccggacgacacagcggcgcgcaaactcgccgccatcgcggtgagcgtcaatcag
acgctgcaggagcgcgccagccgcatctcgggcaccatcggcaaccatcgccgggtcatc
ggtcacgaatgggtggcaagcctcgacgggcacgaaattcaggtcacatgcgaagcttcc
gccgacggcacctatgtacgctttgccgacgggacatctgtctccgtcgcaactgactgg
acccccggtcgcacccgtgccgctttcaacatagaaaatcagccgatgagcgtgaaggtc
gagcttgccggcaccggaataaggctgcgctggcgcgggatcgacgtcgttgcacgggtc
agaagcccacacattgccgaactcgcccggctgatgccgaagaagctgccgccggacacg
tcgaagatgctgctctgcccgatgccgggggtagtgacgtcgatcacggtgaaggccggg
gagacagtggaggccggacaggcgatcgccgtcgtcgaggcaatgaagatggagaatata
ttgagggcggaaagacgctcgatcgtgaagcgcgtggcgatcgaagccggggcgagcctg
gccgtggacgagttgatcatggagttcgagtga
DBGET
integrated database retrieval system