Sinorhizobium medicae: Smed_6081 Help Entry Smed_6081         CDS       T00555                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism smd  Sinorhizobium medicae Pathway smd01100   Metabolic pathways smd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:smd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Smed_6081    00074 Mycolic acid biosynthesis     Smed_6081   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Smed_6081 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ABR64726 UniProt:  A6UM46 LinkDB All DBs Position pSMED02:1015252..1015503 Genome browser AA seq 83 aa AA seqDB search MEKSSADVSNRIRAIIVEQLGVDPAHAVDDASLVDDLGADFLEVAQIVMMIQDEFNIELS DDVAEAVITVGDAIYVVTSKTKS NT seq 252 nt NT seq  +upstreamnt  +downstreamnt gtggaaaaatccagcgcggacgtctctaatcgtataagagcaataatcgtcgagcagttg ggcgtcgaccctgcccatgctgtggacgacgcgtctctggtcgatgacctgggcgccgac tttctcgaagtcgctcaaatcgtcatgatgatccaggacgagttcaatatcgaactttca gatgacgtggccgaggccgttatcacggtcggagatgcaatttacgtggttacgtcgaaa accaagagctaa

DBGET integrated database retrieval system