KEGG   Sinorhizobium medicae: Smed_6274
Entry
Smed_6274         CDS       T00555                                 
Name
(GenBank) multi-sensor signal transduction histidine kinase
  KO
K14986  two-component system, LuxR family, sensor kinase FixL [EC:2.7.13.3]
Organism
smd  Sinorhizobium medicae
Pathway
smd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:smd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Smed_6274
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:smd01001]
    Smed_6274
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:smd02022]
    Smed_6274
Enzymes [BR:smd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     Smed_6274
Protein kinases [BR:smd01001]
 Histidine kinases
  LuxR family [OT]
   Smed_6274
Two-component system [BR:smd02022]
 LuxR family
  FixL-FixJ (nitrogen fixation)
   Smed_6274
SSDB
Motif
Pfam: HATPase_c PAS PAS_9 PAS_4 HisKA PAS_8 HATPase_c_5 DUF4118 Diguanyl_cycl_sensor HATPase_c_2
Other DBs
NCBI-ProteinID: ABR64872
UniProt: A6UMJ2
LinkDB
Position
pSMED02:complement(1192563..1194167)
AA seq 534 aa
MVYGIAEMRWAVSDAGCSSNTSSSPVDNGMHAESVVERTRLGQKLVRWRGDGISAYVLGT
VAVLNILAIRLAFRELFGDSFLLLSLTPAVLVVAMVGGLKPITFAAGLSLLAASSLRWIE
NPFEPTIGELIAFGSTLLLIVALGEVLQAARRAIDRTEGVVRARDAHLRSILDTVPDATV
VSATDGTIVSFNAAAVRQFGYAEEEVIGQNLRILMPEPYRHEHDGYLQRYMATGEKRIIG
IDRVVSGQRKDGSTFPMKLAVGEMRSGGERFFTGFIRDLTEREESAARLEQIQDELARLA
RLNEMGEMASTLAHELNQPLSAIANYSHGCTRLLRDMDDAVATRMREALEEVASQSLRAG
QIIKHLREFVTNGETEKAPEDIRKLVGESAALALVGSREQGVRTVFEYLPDAEMVMVDRI
QVQQVLINLMRNAIEAMRHVDRRELTIRTMPADPGEIAVVVEDSGGGIPEEVAGQLFKPF
VTTKASGMGIGLSISKRIVEAHGGEMTVSKNAAGGATFRFTLPAYLEERIVAND
NT seq 1605 nt   +upstreamnt  +downstreamnt
atggtctatgggatagccgagatgcggtgggccgtatccgacgctgggtgcagcagtaat
acatcatcgtctccggtggataacggaatgcatgcagaaagcgttgttgagaggacgagg
ctcgggcagaagctcgtccggtggcgaggcgacgggatctcggcctatgttctcgggact
gtagctgtcttaaacattcttgccattagactcgcatttcgggaactcttcggcgacagc
tttctgctcttgtcgcttacccctgccgttctcgtggtcgcgatggtcggcgggctgaaa
ccgatcaccttcgcagcagggctttcgcttcttgcagcatcatctcttcgttggatagag
aacccgttcgagccgacaatcggcgagctgatcgccttcggctcgacactgctcctgatc
gtggctctgggagaagtgcttcaggcggcaagacgcgccatcgaccggaccgagggtgtc
gtaagagcccgcgacgcgcatctgagatccatactggatactgttccggatgccacagtg
gtcagcgctaccgacggcacaatcgtatccttcaacgccgcggccgtccggcagttcgga
tacgctgaggaggaggtcatcggccagaacctgcgcatattgatgccggaaccctaccgc
cacgaacacgacggatatctgcagcgctacatggcaaccggggaaaagcgcatcatcggt
atcgatcgcgttgtctcggggcagcggaaggatggatcgacgtttccgatgaagctcgcc
gtgggggagatgcgctcgggcggcgagaggttcttcacaggcttcatcagagaccttacg
gagcgggaggagtctgccgcacggctcgagcagatacaggatgaactggcgcgccttgcc
cgcctaaacgagatgggcgaaatggcttcgacgcttgcccacgaactgaaccagccgttg
tcggcgatcgccaactattcgcatggctgtacgaggctgttgcgtgacatggacgacgcc
gtcgctacgcgaatgcgagaggcgctcgaagaggtggcgagccagtcgctgcgggccggc
cagatcatcaaacatctgagggaattcgtcaccaacggcgagacggagaaggctccggaa
gacattcgcaagctggtcggggagtctgcggccctggctctggtcggttcgcgcgagcag
ggcgtccgcaccgtattcgagtatctgcccgatgccgaaatggtaatggtcgaccggatc
caggtgcagcaggtcctcatcaatctgatgcgcaacgcgatagaggcgatgcgccacgtc
gaccgccgggagctgacgatccgcacgatgccggccgatccgggcgagatagcagtcgtc
gttgaagactccggcggaggcattccggaagaagtcgccggtcagctcttcaagccgttc
gtcacgaccaaggcaagcggaatgggcatcggactgtccatttcgaagcggatcgtcgag
gcgcatggcggtgagatgactgtctcgaaaaatgcagccggcggggccactttccggttc
acgcttcccgcctatctagaagaacggatcgttgcaaatgactga

DBGET integrated database retrieval system