Sinorhizobium meliloti 1021: SMc00573 Help Entry SMc00573          CDS       T00058                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism sme  Sinorhizobium meliloti 1021 Pathway sme01100   Metabolic pathways sme01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sme00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SMc00573 (acpP)    00074 Mycolic acid biosynthesis     SMc00573 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SMc00573 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Delta_lysin Motif Other DBs NCBI-ProteinID:  CAC45722 UniProt:  P19372 LinkDB All DBs Position 1242713..1242949 Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVIDHLGVDAEKVSEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA DSILTVGDAVKFIEKAQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgcagaacgcgtgaagaaaattgttattgatcatcttggcgtcgacgcc gaaaaggtcagcgaaggcgcaagcttcatcgatgacctcggcgcggactcgctcgacacc gtcgaactggtcatggcattcgaagaggaattcggtgtcgaaatcccggacgacgcagca gattcgatcctcaccgttggcgacgccgtcaagttcatcgagaaagcccaggcctga

DBGET integrated database retrieval system