Sinorhizobium meliloti 1021: SMc01553 Help Entry SMc01553          CDS       T00058                                  Name (GenBank) Putative acyl carrier protein   KO K02078   acyl carrier protein Organism sme  Sinorhizobium meliloti 1021 Pathway sme01100   Metabolic pathways sme01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sme00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SMc01553    00074 Mycolic acid biosynthesis     SMc01553   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SMc01553 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  CAC46883 UniProt:  Q92NA8 LinkDB All DBs Position 2493890..2494138 Genome browser AA seq 82 aa AA seqDB search MSDHQLYLSQVADVIRELFDEYDGPITLETTARDVPQWDSLSNVRLMVLIEQELAVRFST AEVQGFKNLGSLIDAVVKRKQN NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgtctgaccatcaactttatctatcccaagtcgcagacgtgatccgtgagctgttcgat gaatacgacggcccgatcaccctggagacgacggcccgcgacgttccgcaatgggacagc ctgtccaatgtcagactgatggttctgatcgagcaggagctcgcagtccgcttcagcacg gctgaggtgcaaggtttcaagaacctcggcagccttatcgatgccgtggtcaagcgcaag cagaactga

DBGET integrated database retrieval system