Sinorhizobium meliloti 1021: SMc02140
Help
Entry
SMc02140 CDS
T00058
Symbol
phoB
Name
(GenBank) Phosphate regulon transcriptional regulatory protein
KO
K07657
two-component system, OmpR family, phosphate regulon response regulator PhoB
Organism
sme
Sinorhizobium meliloti 1021
Pathway
sme02020
Two-component system
Brite
KEGG Orthology (KO) [BR:
sme00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
SMc02140 (phoB)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
sme02022
]
SMc02140 (phoB)
Two-component system [BR:
sme02022
]
OmpR family
PhoR-PhoB (phosphate starvation response)
SMc02140 (phoB)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Trans_reg_C
Response_reg
GerE
Motif
Other DBs
NCBI-ProteinID:
CAC45087
UniProt:
Q52990
LinkDB
All DBs
Position
572383..573066
Genome browser
AA seq
227 aa
AA seq
DB search
MLPKIAVVEDEEALSVLLRYNLEAEGFEVDTILRGDEAEIRLQERLPDLLILDWMLPGVS
GIELCRRLRQRPETERLPIIMLTARGEESERVRGLATGADDYVVKPFSTPELMARVKAML
RRAKPEVLSTLLRCGDIELDRETHRVHRRSREVRLGPTEFRLLEFLMSSPGRVFSRSQLL
DGVWGHDIYVDERTVDVHVGRLRKALNFSNMPDVIRTVRGAGYSLES
NT seq
684 nt
NT seq
+upstream
nt +downstream
nt
atgttgccgaagattgccgtagtcgaagatgaggaagccctaagcgttctcctgcgctac
aatctcgaggcagaaggcttcgaggtcgatacgatccttcgcggcgacgaggcggagatc
cgcctgcaggagcgcctgcccgaccttctcatcctcgattggatgctgcccggggtttcc
ggcatcgagctctgccgcaggctgcgccagcggccggaaacggagcgcctgccgatcatc
atgctgacggcgcgcggcgaggagagcgagcgcgtgcggggccttgccaccggggccgac
gattacgtcgtcaagcccttctcgacgccggaactgatggcgagggtcaaggctatgctc
aggcgcgccaagcccgaggttctgtcgacgctcctgcgctgcggcgatatcgagctcgac
cgggagacgcaccgcgtccaccgccgcagccgtgaagtgcgcctcggcccgacggagttc
cggctgctggaatttctcatgtcctcaccggggcgcgtcttctcccgttcacagctcctg
gacggtgtctgggggcacgacatctatgtcgacgaacggaccgtggacgtccatgtcgga
cgtctgcgcaaggcactgaacttctccaacatgcccgacgtcatccggacggtgcgcggc
gcgggctattcgctggagagctga
DBGET
integrated database retrieval system