Sinorhizobium meliloti 1021: SMc03858 Help Entry SMc03858          CDS       T00058                                  Symbol pheAa Name (GenBank) Putative chorismate mutase   KO K04092   chorismate mutase [EC:5.4.99.5] Organism sme  Sinorhizobium meliloti 1021 Pathway sme00400   Phenylalanine, tyrosine and tryptophan biosynthesis sme01100   Metabolic pathways sme01110   Biosynthesis of secondary metabolites sme01230   Biosynthesis of amino acids Module sme_M00024   Phenylalanine biosynthesis, chorismate => phenylpyruvate => phenylalanine sme_M00040   Tyrosine biosynthesis, chorismate => arogenate => tyrosine Brite KEGG Orthology (KO) [BR:sme00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     SMc03858 (pheAa) Enzymes [BR:sme01000]  5. Isomerases   5.4  Intramolecular transferases    5.4.99  Transferring other groups     5.4.99.5  chorismate mutase      SMc03858 (pheAa) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CM_2 Chordopox_L2 Motif Other DBs NCBI-ProteinID:  CAC47820 UniProt:  Q92L44 LinkDB All DBs Position 3524020..3524355 Genome browser AA seq 111 aa AA seqDB search MLDPEIKEELASYRQSIDNIDAALVHMLAERFRCTKAVGVLKAKHQLPPADPAREEYQIE RLRHLAKDANLDPDFAEKFLNFIIKEVIRHHEAIAADCSQNAGSAGTTHSA NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atgcttgatcccgagatcaaagaggaattggcgagctaccggcagtcgatcgacaatatc gatgccgcgctcgtccacatgctggccgaacgcttccgctgcaccaaggcggttggcgtg ctcaaggccaagcaccagctgccgccggccgatccggcgcgcgaagaataccagatcgaa cgcctccgccacctggcgaaagacgccaatctggatccggatttcgccgagaagttcctg aacttcatcatcaaggaagtcatccggcatcatgaagccatcgccgccgattgctcgcag aacgcgggcagcgccggcaccacccattccgcttga

DBGET integrated database retrieval system