Sinorhizobium meliloti GR4: C770_GR4pB095 Help Entry C770_GR4pB095     CDS       T02405                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism smeg  Sinorhizobium meliloti GR4 Pathway smeg01100   Metabolic pathways smeg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:smeg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C770_GR4pB095    00074 Mycolic acid biosynthesis     C770_GR4pB095   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C770_GR4pB095 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AGA08573 LinkDB All DBs Position pRmeGR4b:complement(79427..79678) Genome browser AA seq 83 aa AA seqDB search MEKSSADVSNRIRAIIVEQLGVDPAHAVDDASLVDDLGADFLEVAQIMMMIQDEFNIELS DDVAEAVITVGDAIYVVTSKTKS NT seq 252 nt NT seq  +upstreamnt  +downstreamnt gtggaaaaatccagcgcggatgtctctaaccgtataagagcaataatcgtcgagcagttg ggcgtcgaccctgcccatgctgtggacgacgcgtctctggtcgatgacctcggcgccgac tttctcgaagtcgctcaaatcatgatgatgattcaggacgagttcaatatcgaactttca gatgacgtggccgaggccgttatcacggtcggagatgcaatttacgtggttacgtcgaaa accaagagctaa

DBGET integrated database retrieval system