Sinorhizobium meliloti 2011: SM2011_b22007 Help Entry SM2011_b22007     CDS       T02497                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism smel  Sinorhizobium meliloti 2011 Pathway smel01100   Metabolic pathways smel01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:smel00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SM2011_b22007    00074 Mycolic acid biosynthesis     SM2011_b22007   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SM2011_b22007 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AGG71596 LinkDB All DBs Position pSymB:complement(633126..633377) Genome browser AA seq 83 aa AA seqDB search MSDHQLYLSQVADVIRELFDEYDGPITLETTARDVPQWDSLSNVRLMVLIEQELAVRFST AEVQGFKNLGSLIDAVVKRKQNQ NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgtctgaccatcaactttatttatcccaagtcgcagacgtgatccgtgagctgttcgat gaatacgacgggccgattacgctggagacgaccgcccgcgacgttccgcaatgggacagc ctgtccaatgtcagactgatggttctgatcgagcaggagctcgcagtccgcttcagcacg gcggaggtgcaaggtttcaagaacctcggcagccttatcgatgccgtggtcaagcgcaag cagaaccaatag

DBGET integrated database retrieval system