KEGG   Sinorhizobium meliloti 2011: SM2011_c00024
Entry
SM2011_c00024     CDS       T02497                                 
Symbol
smc
Name
(GenBank) Putative chromosome partition protein
  KO
K03529  chromosome segregation protein
Organism
smel  Sinorhizobium meliloti 2011
Brite
KEGG Orthology (KO) [BR:smel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:smel03036]
    SM2011_c00024 (smc)
Chromosome and associated proteins [BR:smel03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Condensin-like complex
    SM2011_c00024 (smc)
SSDB
Motif
Pfam: SMC_N AAA_23 AAA_21 AAA_15 SMC_hinge AAA_29 ABC_tran
Other DBs
NCBI-ProteinID: AGG73510
LinkDB
Position
1019415..1022876
AA seq 1153 aa
MKFTRLRLLGFKSFVEPTEFVIERGLTGVVGPNGCGKSNLVEALRWVMGENSYKNMRASG
MDDVIFSGSGNRPARNTAEVGLYLDNSDRTAPAAFNDSDEIQVTRRIEREQGSVYRINGK
EARAKDVQLLFADASTGARSPSMVGQGRIGELIAAKPQARRQLLEEAAGISGLHSRRHEA
ELRLKAAETNLERLDDVTSQLESQIESLKRQARQANRFKMLSAEIRRHEAILFHTRWVQA
KEAEAEATSHLNQITALVAEKAQAQMEAAKAQAVASLKLPELRENEAKFAAGLQRLQIAR
AQLEEDAGRILRRREELQRRLAQLAEDIAREERLVADNAGILARLDQEEEELRDVLAEAD
DRGAQARERLDEANEKLAASEAGLARITAERAEAQAARNQIERALRDLSERQARLARQLA
DQGRELDDLDGQMARLPDPDEKREQVELAEAALEEAEAAVAAVEESLAEARADEAAARLP
VDQARARLNGIETEARTIRRMLEAAGGSTYPAVVEEMKVERGFEAALGAALGDDLDSPLE
QAAPTHWRMPGDDAEDPALPAGALPLIDFVQAPEALRRALRQIGIVESDGEAERLLPLLR
AGQRLVTRQGAVWRWDGHVTGSEAPSAAGLRLAQKNRLSELEGEAEEASDASLKAEAHLA
AAGARIRAEDERLRLSREAQRMLARQLSEARDALAVAERASGDLARRRAVLAETKLQIEG
QAEEIAEEIEAAKEASAGQPDLAELDLRLSRRTAEVATDRAAAAEARAAHDGLARENDGR
LRRLAAIAGERETWAARAASAEDHIATLREREAEAREEVEELLDAPDEFDDKRRALMNEL
QKAEASRREAADRLAEAENHQREADRQAATALSELAEVREKRGRAEERLVSARERRVEIE
ARILEALSCAPHEVMRLTGLGSDEGLPDMRGVERELERLKIERERLGAVNLRADEEQKEL
SERLAALLKERDDVIEAIRRLRSAIQNLNREGRERLIAAFDVVNVQFQRLFTHLFGGGTA
ELQLIESDDPLEAGLEILARPPGKKPQTMTLLSGGEQALTAMALIFAVFLTNPAPICVLD
EVDAPLDDHNVERYCNLMDEMAASTETRFVIITHNPITMARMNRLFGVTMAEQGVSQLVS
VDLQTAERLREAV
NT seq 3462 nt   +upstreamnt  +downstreamnt
atgaaattcaccaggctgcgcctgctcggcttcaaatccttcgtcgaaccgacggaattc
gtcatcgagcgtggcctgaccggggtcgtcgggccgaacggctgcggcaagtccaatctt
gtcgaggcgctccgctgggtgatgggcgagaactcctacaagaacatgcgtgcctccggc
atggacgacgtgatcttttccggatccggcaaccgcccggcgcgcaacacggccgaggtc
ggcctgtatctggacaacagcgaccgcaccgcgcccgcagccttcaacgacagcgacgag
atacaggtgacgcgccgcatcgagcgcgagcagggctcggtctaccgcatcaatggcaag
gaggcgcgcgccaaggacgtgcagttgctgtttgccgatgcgtccaccggtgcacgctcg
ccctcgatggtgggccagggccgcatcggcgagctgatcgccgccaagccgcaggcgcgc
cggcagctgctcgaggaggcggccggcatttccggcctgcattcgcgccgccatgaggcg
gaactgcggctgaaggctgccgaaaccaatctcgagcgcctggacgacgttacctcgcag
ctcgaaagccagatcgagagcctcaagcgccaggcgcgccaggccaaccggttcaagatg
ctgtctgcggaaatccgccggcacgaggcgatcctgttccatacccgctgggtgcaggcc
aaggaagcggaggccgaggcgaccagccacctgaaccagatcactgcactcgtcgccgag
aaggcgcaggcgcagatggaagccgccaaggctcaggccgtcgcgagcctcaagctgccg
gaactgcgtgaaaacgaggcgaagttcgctgccgggctgcagcgcctgcagatcgctcgc
gcccagctcgaggaggatgccggccggatcctgcgccgccgtgaggaattgcagcggcgg
ctggcgcaacttgcggaggacatcgcccgcgaagagcggctggtcgccgacaatgccggc
attctcgcccgcctcgatcaggaggaggaagaactgcgggacgtgctggccgaggcggat
gatcgcggcgctcaggcacgtgaaaggctcgatgaggccaatgaaaagcttgcggcgagc
gaagccggtctcgcccgcattacggccgagcgcgccgaggcgcaggccgcgcgcaaccag
atcgagagagcgctacgcgatctctccgagcggcaggctcgccttgcacgccagcttgcg
gatcaggggcgtgaactcgacgatcttgacggtcagatggcgcgactccccgatccggac
gagaagagagagcaggtcgagcttgcggaggcggcgctggaggaggccgaggccgccgtc
gccgccgtcgaagagagcctcgccgaggcgcgcgccgacgaagccgccgcgcgcctgccc
gtcgaccaggcccgggcgcggctgaacggcatcgagacggaagcgcgaacgatccggcgc
atgctggaggcggccggcggcagcacctatccggccgtcgtagaggagatgaaagtcgag
cgcggcttcgaggcggcgcttggcgcggctcttggcgacgacctcgattcgcctctggaa
caggcggcgccgacgcactggcgcatgcccggcgacgatgcggaagatcccgcattgccg
gccggcgccctgcctttgatcgatttcgtccaggcaccggaggcgctgaggcgagcgctc
cggcagatcgggatcgtagagagcgacggggaggcggagcgactgctgccgctcctcagg
gccggccagcggctggtgacgagacagggcgccgtctggcgatgggacggccacgtcacc
ggctcggaagcgccaagtgctgcgggcctgagacttgcccagaagaaccgcctttccgaa
ctggaaggtgaggcggaggaggcgagcgatgcatcgctgaaggcggaggcgcatcttgcc
gctgccggcgcgcgcatccgcgccgaggacgagcggctaaggctttcgcgcgaggcgcaa
cgcatgcttgcacggcagctctccgaggcgcgcgatgccctggcggtggccgagcgggcg
tccggcgatctggcgcgccgccgcgcggtgcttgccgagacgaagctccagatcgaaggc
caggccgaggagatcgccgaagagatcgaggcggccaaggaagcctctgccggtcagccg
gatcttgcagaactcgacctgcggctgagcaggcggacggccgaagtcgcgaccgaccgt
gcggcggcggccgaggctcgcgctgcacatgacggtctcgcacgcgaaaacgatgggcgc
ctcaggcggcttgcggccatcgccggggagcgagagacctgggcagcgagggcggccagc
gccgaagatcacatcgcgacgcttcgcgagcgcgaggcggaggcgcgggaggaggtcgag
gaactgctcgatgcgcctgacgagttcgacgacaagcgccgcgcgctgatgaacgagctg
cagaaggcggaggcgtcgcgccgagaggcggccgacagactcgccgaggcggaaaaccat
caacgcgaagcggatcgccaggccgctaccgcgctctcggagctggcagaggtacgcgaa
aagcgcggccgcgccgaagagcggcttgtttccgcgcgggagcggcgtgtcgagatcgag
gcacgcattctcgaagcactgtcctgcgccccccatgaagtgatgcgccttaccggtctc
ggctccgacgaaggactaccggatatgcgcggcgtcgaacgggaactcgagcggctgaag
atcgagcgggaacggctcggcgccgtcaacctgcgcgccgacgaggagcagaaggagctt
tcggagcggctcgcggcgctgctcaaggaacgtgacgacgtcatcgaggcgatccgccgg
ttgaggagtgccatccagaacctcaaccgcgagggccgcgagcggctgattgccgcgttc
gatgtggtcaatgtgcagttccagcggcttttcacccacctcttcgggggcggcacggcg
gaactgcagctcatcgagagcgacgacccgttggaagcggggctcgaaatccttgcccgg
ccgcccggcaaaaaaccgcagacgatgacgctgctttccggcggggagcaggcgttgact
gccatggcgctgatctttgccgtcttcctcaccaatccggcaccgatctgcgttctcgat
gaggtggatgcgccgctcgacgaccacaatgtcgagcgctattgcaacctgatggacgaa
atggcggcctccaccgagacccgcttcgtcatcatcacccacaatccgattaccatggcc
cggatgaaccgcctgttcggggtcacaatggccgagcagggcgtctcgcagctcgtctcg
gtagacctgcagacggcagagcggctgcgcgaagccgtctga

DBGET integrated database retrieval system