Sinorhizobium meliloti 2011: SM2011_c01553 Help Entry SM2011_c01553     CDS       T02497                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism smel  Sinorhizobium meliloti 2011 Pathway smel01100   Metabolic pathways smel01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:smel00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SM2011_c01553    00074 Mycolic acid biosynthesis     SM2011_c01553   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SM2011_c01553 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AGG74895 LinkDB All DBs Position 2493464..2493712 Genome browser AA seq 82 aa AA seqDB search MSDHQLYLSQVADVIRELFDEYDGPITLETTARDVPQWDSLSNVRLMVLIEQELAVRFST AEVQGFKNLGSLIDAVVKRKQN NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgtctgaccatcaactttatctatcccaagtcgcagacgtgatccgtgagctgttcgat gaatacgacggcccgatcaccctggagacgacggcccgcgacgttccgcaatgggacagc ctgtccaatgtcagactgatggttctgatcgagcaggagctcgcagtccgcttcagcacg gctgaggtgcaaggtttcaagaacctcggcagccttatcgatgccgtggtcaagcgcaag cagaactga

DBGET integrated database retrieval system