Silurus meridionalis (southern catfish): 124375816
Help
Entry
124375816 CDS
T08004
Symbol
drg2
Name
(RefSeq) developmentally-regulated GTP-binding protein 2
KO
K27705
developmentally-regulated GTP-binding protein 2 [EC:3.6.5.-]
Organism
smeo
Silurus meridionalis (southern catfish)
Brite
KEGG Orthology (KO) [BR:
smeo00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03012 Translation factors [BR:
smeo03012
]
124375816 (drg2)
03036 Chromosome and associated proteins [BR:
smeo03036
]
124375816 (drg2)
Translation factors [BR:
smeo03012
]
Eukaryotic type
Elongation factors
Elongation associated factors
124375816 (drg2)
Chromosome and associated proteins [BR:
smeo03036
]
Eukaryotic type
Centrosome formation proteins
Microtubules and associated factors
Microtubule-associated proteins
124375816 (drg2)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
MMR_HSR1_Xtn
MMR_HSR1
TGS
FeoB_N
Dynamin_N
Motif
Other DBs
NCBI-GeneID:
124375816
NCBI-ProteinID:
XP_046690427
LinkDB
All DBs
Position
22:8905075..8908835
Genome browser
AA seq
364 aa
AA seq
DB search
MGILEKIAEIEREITRTQKNKATEYHLGLLKAKLAKYRAQLLEPSKSAGAKGEGFDVMKS
GDARVALIGFPSVGKSTFLSLMTSTESEAASYEFTTLTCIPGVIEYKGANIQLLDLPGII
EGAAQGKGRGRQVIAVARTADVVIMMLDATKGEVQRELLEKELESVGIRLNRSKPNIYFK
PKKGGGLSFNSTVPLTHCSEKLVQLILHEYKIFNAEVLFREDCTSDEFIDVIVGNRVYMP
CLYVYNKVDQISIEEVDRLARQSNSVVISCGMKLNLDYLMEQLWEYLALICLYTKKRGER
PDFGDPIIMRRGASVEHVCHRVHRTLASQFKYALVWGTSTKYSPQRVGLTHIMEHEDVIQ
IVKK
NT seq
1095 nt
NT seq
+upstream
nt +downstream
nt
atgggaattctggagaagatagccgagatcgagcgagaaatcactcgaactcagaaaaac
aaagcaaccgagtaccatcttggtttgctaaaagccaagctcgccaagtacagagcccag
cttctggagccttcaaagtcggccggagccaaaggtgaaggctttgatgttatgaaatca
ggtgatgccagagttgctctaattggatttccatcagttggcaagtctacctttctgagc
ttaatgacctcaacggaaagcgaagcagcttcatatgagttcactacactgacctgcatc
ccaggtgttattgagtataaaggtgccaacattcagctgctggatttgcctggaattatt
gaaggagctgctcaaggtaagggtagaggcagacaggtgatagctgtagccagaactgca
gatgtggttatcatgatgctggatgcaaccaaaggtgaggtacaaagggaacttctggaa
aaagaacttgaatctgttgggatccgactcaaccggtccaaacccaacatttactttaag
cccaagaaaggtggtggtctgtctttcaattcaactgttccactcacacattgctctgag
aagcttgtgcagctcattcttcatgagtataaaatcttcaatgctgaggttttgtttagg
gaggactgtacatcagatgaatttattgatgtcattgtgggcaacagagtgtacatgcct
tgtttatatgtgtacaacaaagtggaccagatttcaatagaagaagtagaccgcctcgca
cgtcagtccaacagcgtggtgatcagctgtggcatgaaactgaatctagactacctcatg
gagcagctgtgggaatacctggctctgatttgtctttacaccaaaaagagaggagaacgg
ccagattttggtgacccaatcatcatgagaagaggtgcatcagtagaacatgtgtgccac
agagtccacagaacattagccagccagttcaagtacgcacttgtctggggaacgagcacg
aagtacagcccgcagcgagtcggactgacacacattatggaacatgaggatgtcattcaa
attgtgaagaaataa
DBGET
integrated database retrieval system