Silurus meridionalis (southern catfish): 124379989 Help Entry 124379989         CDS       T08004                                  Symbol hrasb Name (RefSeq) HRas proto-oncogene, GTPase b   KO K02833   GTPase HRas Organism smeo  Silurus meridionalis (southern catfish) Pathway smeo04010   MAPK signaling pathway smeo04012   ErbB signaling pathway smeo04068   FoxO signaling pathway smeo04137   Mitophagy - animal smeo04140   Autophagy - animal smeo04144   Endocytosis smeo04150   mTOR signaling pathway smeo04210   Apoptosis smeo04218   Cellular senescence smeo04370   VEGF signaling pathway smeo04371   Apelin signaling pathway smeo04510   Focal adhesion smeo04519   Cadherin signaling smeo04540   Gap junction smeo04625   C-type lectin receptor signaling pathway smeo04810   Regulation of actin cytoskeleton smeo04910   Insulin signaling pathway smeo04912   GnRH signaling pathway smeo04916   Melanogenesis smeo05132   Salmonella infection Brite KEGG Orthology (KO) [BR:smeo00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     124379989 (hrasb)    04012 ErbB signaling pathway     124379989 (hrasb)    04370 VEGF signaling pathway     124379989 (hrasb)    04371 Apelin signaling pathway     124379989 (hrasb)    04068 FoxO signaling pathway     124379989 (hrasb)    04150 mTOR signaling pathway     124379989 (hrasb)   09133 Signaling molecules and interaction    04519 Cadherin signaling     124379989 (hrasb)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     124379989 (hrasb)    04140 Autophagy - animal     124379989 (hrasb)    04137 Mitophagy - animal     124379989 (hrasb)   09143 Cell growth and death    04210 Apoptosis     124379989 (hrasb)    04218 Cellular senescence     124379989 (hrasb)   09144 Cellular community - eukaryotes    04510 Focal adhesion     124379989 (hrasb)    04540 Gap junction     124379989 (hrasb)   09142 Cell motility    04810 Regulation of actin cytoskeleton     124379989 (hrasb)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     124379989 (hrasb)   09152 Endocrine system    04910 Insulin signaling pathway     124379989 (hrasb)    04912 GnRH signaling pathway     124379989 (hrasb)    04916 Melanogenesis     124379989 (hrasb)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     124379989 (hrasb)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:smeo04131]     124379989 (hrasb)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:smeo04147]     124379989 (hrasb)    04031 GTP-binding proteins [BR:smeo04031]     124379989 (hrasb) Membrane trafficking [BR:smeo04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     124379989 (hrasb)  Endocytosis   Macropinocytosis    Ras GTPases     124379989 (hrasb) Exosome [BR:smeo04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    124379989 (hrasb)   Exosomal proteins of colorectal cancer cells    124379989 (hrasb) GTP-binding proteins [BR:smeo04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     124379989 (hrasb) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin DUF6974 Ldh_1_N Motif Other DBs NCBI-GeneID:  124379989 NCBI-ProteinID:  XP_046696610 LinkDB All DBs Position 26:3289254..3301013 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDDNGQD CMNCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtataaactggtggtggttggtgctggtggcgtgggcaagagcgccctcacc attcaactgattcagaaccactttgttgacgagtacgaccctacaattgaagactcgtac aggaaacaggtggtgatcgatggcgagacgtgtctgctggacattctggacacggccggt caggaggagtacagcgccatgagggaccagtacatgaggacaggagagggcttcctctgt gtcttcgctatcaacaacacaaagtcgttcgaggacatccaccagtacagggagcagatc aaaagggtaaaagattccgatgacgtccccatggtgctcgtgggtaataaatgcgacctg ccagctcgtacagtggacacaaggcaagcccaggaactggcccgcagttacggcatccct tatatcgaaacgtccgccaagacacgacagggagtggaggacgcgttctacacactggtg cgtgaaatcaggcagcacaagctcagaaagctgaatccaccggacgacaacggccaagac tgcatgaactgccgttgcgtcgtgtcatga

DBGET integrated database retrieval system