Silurus meridionalis (southern catfish): 124384246 Help Entry 124384246         CDS       T08004                                  Symbol s100a10b Name (RefSeq) protein S100-A10b   KO K17274   protein S100-A10 Organism smeo  Silurus meridionalis (southern catfish) Pathway smeo04382   Cornified envelope formation smeo05132   Salmonella infection Brite KEGG Orthology (KO) [BR:smeo00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     124384246 (s100a10b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     124384246 (s100a10b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:smeo04147]     124384246 (s100a10b) Exosome [BR:smeo04147]  Exosomal proteins   Exosomal proteins of microglial cells    124384246 (s100a10b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_8 EH Bcl-2 Motif Other DBs NCBI-GeneID:  124384246 NCBI-ProteinID:  XP_046702895 LinkDB All DBs Position 4:complement(10443896..10445818) Genome browser AA seq 99 aa AA seqDB search MPSDLERAMETLITVFHRYAGKDGNTVTLSRRELRQLMESELSSFLKSQKDPAAVDKIMK DLDTNGDGEVNFEEFVALVVGLSIACEQCYQMHLNKTKK NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgccgtctgatctggagagagctatggaaacgctgatcactgtgttccaccgttatgcg ggtaaagatggcaatacagtcacactgagccgccgagagctcaggcagctcatggaatcg gagctcagcagcttccttaagtctcagaaagaccctgctgctgttgacaagattatgaaa gatctggacaccaatggcgatggagaggtgaactttgaagagtttgtggcccttgtggtc ggtctgtccattgcctgtgaacagtgttaccagatgcaccttaataaaacaaaaaagtaa

DBGET integrated database retrieval system