Silurus meridionalis (southern catfish): 124386822 Help Entry 124386822         CDS       T08004                                  Name (RefSeq) C-C motif chemokine 18-like   KO K05408   C-C motif chemokine 3 Organism smeo  Silurus meridionalis (southern catfish) Pathway smeo04060   Cytokine-cytokine receptor interaction smeo04620   Toll-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:smeo00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     124386822  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     124386822  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:smeo04052]     124386822    00536 Glycosaminoglycan binding proteins [BR:smeo00536]     124386822 Cytokines and neuropeptides [BR:smeo04052]  Cytokines   Chemokines    124386822 Glycosaminoglycan binding proteins [BR:smeo00536]  Heparan sulfate / Heparin   Chemokines    124386822 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 HTH_animal Motif Other DBs NCBI-GeneID:  124386822 NCBI-ProteinID:  XP_046706754 LinkDB All DBs Position 6:complement(30695586..30696897) Genome browser AA seq 93 aa AA seqDB search MISRGLLLVLLVLTCLQSFTTAQNGNGPDSCCFSYQRTPIPIRVITGYKVTDPQCTKLGV IFTLKNSRRVCVDPEVDWVQKHMKSIDQILSEI NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgatctctcgtggtctcctgctggttctgctggttctcacctgccttcagtcttttaca acggcccagaatggaaatggaccagactcatgctgcttcagttaccagagaactccaatc cctatcagagtcattacagggtataaagtaacagaccctcagtgtacaaaacttggagtc atctttaccctgaagaacagccgtcgtgtgtgtgtagatcctgaagtcgactgggtgcag aaacacatgaaaagtattgaccagatcctgagcgaaatttga

DBGET integrated database retrieval system