Silurus meridionalis (southern catfish): 124387776 Help Entry 124387776         CDS       T08004                                  Symbol cxcl19 Name (RefSeq) C-X-C motif chemokine 19   KO K10030   interleukin 8 Organism smeo  Silurus meridionalis (southern catfish) Pathway smeo04060   Cytokine-cytokine receptor interaction smeo04218   Cellular senescence smeo04620   Toll-like receptor signaling pathway smeo04621   NOD-like receptor signaling pathway smeo04622   RIG-I-like receptor signaling pathway smeo05132   Salmonella infection Brite KEGG Orthology (KO) [BR:smeo00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     124387776 (cxcl19)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     124387776 (cxcl19)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     124387776 (cxcl19)    04621 NOD-like receptor signaling pathway     124387776 (cxcl19)    04622 RIG-I-like receptor signaling pathway     124387776 (cxcl19)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     124387776 (cxcl19)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:smeo04052]     124387776 (cxcl19)    00536 Glycosaminoglycan binding proteins [BR:smeo00536]     124387776 (cxcl19) Cytokines and neuropeptides [BR:smeo04052]  Cytokines   Chemokines    124387776 (cxcl19) Glycosaminoglycan binding proteins [BR:smeo00536]  Heparan sulfate / Heparin   Chemokines    124387776 (cxcl19) SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  124387776 NCBI-ProteinID:  XP_046708292 LinkDB All DBs Position 6:22942315..22949971 Genome browser AA seq 131 aa AA seqDB search MIVVNIRLNSEYLRACNIFWFKVSLKLTLDLTMRFFLLLALMAVSLLLTCAIQPLGKGYN SHCMCVKLESRIIPQHSLRSVEIFPKGSHCKNTEVIASLVSGEKICLNPHTMWVRKLIQF IEKKEKLIKKA NT seq 396 nt NT seq  +upstreamnt  +downstreamnt atgattgttgttaatataagattaaactcagagtatttaagagcatgcaacattttttgg tttaaagtgtctttgaagctaacccttgacttaaccatgagattctttctccttttagct ttgatggcagtcagtcttttactcacttgtgcaatacaacctttggggaaaggctacaac agtcactgcatgtgcgtgaagctggagtccaggataataccacagcacagcctgcgcagt gttgaaatctttcctaaaggctcccactgcaagaatacagaggtcattgcttctttggtg agtggagaaaagatttgcctgaatcctcatactatgtgggttcgaaaacttatccagttc attgagaagaaagaaaaattaattaagaaagcataa

DBGET integrated database retrieval system