Silurus meridionalis (southern catfish): 124392944 Help Entry 124392944         CDS       T08004                                  Name (RefSeq) ras-related protein rab7-like   KO K07897   Ras-related protein Rab-7A Organism smeo  Silurus meridionalis (southern catfish) Pathway smeo04137   Mitophagy - animal smeo04140   Autophagy - animal smeo04144   Endocytosis smeo04145   Phagosome smeo04148   Efferocytosis smeo05132   Salmonella infection Brite KEGG Orthology (KO) [BR:smeo00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     124392944    04145 Phagosome     124392944    04140 Autophagy - animal     124392944    04137 Mitophagy - animal     124392944    04148 Efferocytosis     124392944  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     124392944  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:smeo04131]     124392944   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:smeo04147]     124392944    04031 GTP-binding proteins [BR:smeo04031]     124392944 Membrane trafficking [BR:smeo04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     124392944 Exosome [BR:smeo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    124392944   Exosomal proteins of other body fluids (saliva and urine)    124392944   Exosomal proteins of colorectal cancer cells    124392944   Exosomal proteins of bladder cancer cells    124392944 GTP-binding proteins [BR:smeo04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     124392944 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU RsgA_GTPase ATP_bind_1 cobW nSTAND3 Septin PduV-EutP AAA_16 AAA_7 AAA_22 AAA_24 NTPase_1 G-alpha FLYWCH_N SRPRB AAA_5 ATPase_2 AAA_14 NB-ARC NACHT ABC_tran DUF1441 ATP-synt_ab Motif Other DBs NCBI-GeneID:  124392944 NCBI-ProteinID:  XP_046716606 LinkDB All DBs Position 1:20442153..20445197 Genome browser AA seq 207 aa AA seqDB search MASRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMIEDRLVTLQ IWDTAGQERFQSLGVAFYRGADCCVMVFDVTAPNTFKTLDSWRDEFLIQASPRDPDNFPF LVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPDQIKLERNDGSNSSGSQCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcatccagaaagaaggttcttctaaaagtcatcatacttggggactcaggtgttgga aagacatctttaatgaaccagtatgttaacaagaaattcagcaatcagtacaaagctaca ataggagctgactttcttacaaaggaggtgatgattgaggaccgacttgttactttgcag atttgggacacagctggacaggaaaggtttcagtctctgggggtggcattttatcggggt gcagactgttgtgtgatggtatttgatgttactgctccaaacacatttaagaccctggac tcctggagagatgagtttttgattcaggccagtcctcgtgacccagacaactttcctttt ctggtcttaggcaacaagatcgacctggaaaacagacaggtgacaacaaagcgagcacag gcatggtgtcagagtaaaaacaacattccttacttcgagaccagtgcaaaagaggctatc aatgttgaacaagcctttcaaaccattgcacgaaatgctcttaaacaggaaacagaggta gaactctataatgaatttccagatcagattaagttggagaggaatgacggctccaactcc tcgggatcacagtgcagctgctag

DBGET integrated database retrieval system