Silurus meridionalis (southern catfish): 124394107 Help Entry 124394107         CDS       T08004                                  Symbol rhoca Name (RefSeq) ras homolog family member Ca   KO K04513   Ras homolog gene family, member A Organism smeo  Silurus meridionalis (southern catfish) Pathway smeo04081   Hormone signaling smeo04144   Endocytosis smeo04150   mTOR signaling pathway smeo04270   Vascular smooth muscle contraction smeo04310   Wnt signaling pathway smeo04350   TGF-beta signaling pathway smeo04510   Focal adhesion smeo04520   Adherens junction smeo04530   Tight junction smeo04621   NOD-like receptor signaling pathway smeo04625   C-type lectin receptor signaling pathway smeo04810   Regulation of actin cytoskeleton smeo05100   Bacterial invasion of epithelial cells smeo05132   Salmonella infection Brite KEGG Orthology (KO) [BR:smeo00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     124394107 (rhoca)    04350 TGF-beta signaling pathway     124394107 (rhoca)    04150 mTOR signaling pathway     124394107 (rhoca)   09133 Signaling molecules and interaction    04081 Hormone signaling     124394107 (rhoca)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     124394107 (rhoca)   09144 Cellular community - eukaryotes    04510 Focal adhesion     124394107 (rhoca)    04520 Adherens junction     124394107 (rhoca)    04530 Tight junction     124394107 (rhoca)   09142 Cell motility    04810 Regulation of actin cytoskeleton     124394107 (rhoca)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     124394107 (rhoca)    04625 C-type lectin receptor signaling pathway     124394107 (rhoca)   09153 Circulatory system    04270 Vascular smooth muscle contraction     124394107 (rhoca)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     124394107 (rhoca)    05100 Bacterial invasion of epithelial cells     124394107 (rhoca)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:smeo04131]     124394107 (rhoca)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:smeo04147]     124394107 (rhoca)    04031 GTP-binding proteins [BR:smeo04031]     124394107 (rhoca) Membrane trafficking [BR:smeo04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     124394107 (rhoca) Exosome [BR:smeo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    124394107 (rhoca)   Exosomal proteins of other body fluids (saliva and urine)    124394107 (rhoca)   Exosomal proteins of colorectal cancer cells    124394107 (rhoca)   Exosomal proteins of bladder cancer cells    124394107 (rhoca) GTP-binding proteins [BR:smeo04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     124394107 (rhoca) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  124394107 NCBI-ProteinID:  XP_046718179 LinkDB All DBs Position 1:complement(17379632..17396234) Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDDHTRRELAKMKQEPVKPEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAALQ VRKRKKRGGCLIL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagccatacggaaaaagctggtgatcgtgggagacggagcatgtggaaagacctgt ctactaatagtcttcagtaaggatcagttccccgaagtctacgtgcccactgtgtttgag aactacattgctgacattgaggtggatggcaaacaggtggagctggccctgtgggacact gcaggtcaggaggactatgaccgcttgagaccactttcctacccagacacagatgtcatt cttatgtgcttctctatcgacagtcctgacagtttagagaatattccagagaagtggacg ccagaggtgaaacacttctgccccaacgttcccataattttggtggggaataagaaggac ctgcgcaacgacgaccatactcggagagagctggctaagatgaaacaggagcctgttaaa cccgaggaaggccgcgacatggccaaccgcatcagtgccttcggttacctggagtgctcg gccaagaccaaggagggtgtgagggaagtgtttgaaatggccacaagggcggcgctgcaa gtccggaagaggaaaaagaggggcgggtgcttgatcctgtga

DBGET integrated database retrieval system