Silurus meridionalis (southern catfish): 124394274 Help Entry 124394274         CDS       T08004                                  Symbol hmgb1b Name (RefSeq) high mobility group protein B1b   KO K10802   high mobility group protein B1 Organism smeo  Silurus meridionalis (southern catfish) Pathway smeo03410   Base excision repair smeo04140   Autophagy - animal smeo04217   Necroptosis Brite KEGG Orthology (KO) [BR:smeo00001]  09120 Genetic Information Processing   09124 Replication and repair    03410 Base excision repair     124394274 (hmgb1b)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     124394274 (hmgb1b)   09143 Cell growth and death    04217 Necroptosis     124394274 (hmgb1b)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:smeo03036]     124394274 (hmgb1b)    03400 DNA repair and recombination proteins [BR:smeo03400]     124394274 (hmgb1b)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:smeo04147]     124394274 (hmgb1b) Chromosome and associated proteins [BR:smeo03036]  Eukaryotic type   Nucleosome assembly factors    HMG (high mobility group) proteins     124394274 (hmgb1b) DNA repair and recombination proteins [BR:smeo03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Other BER factors      124394274 (hmgb1b)    MMR (mismatch excision repair)     Other MMR factors      124394274 (hmgb1b) Exosome [BR:smeo04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    124394274 (hmgb1b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HMG_box HMG_box_2 HMG_WDHD1 HMG_box_5 Motif Other DBs NCBI-GeneID:  124394274 NCBI-ProteinID:  XP_046718378 LinkDB All DBs Position 12:complement(20135821..20139156) Genome browser AA seq 198 aa AA seqDB search MVKDPRKPRGKMSSYAYFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSPKEKSKFE DMAKQDKVRYEREMKNYIPPKGEKKKRFKDPNAPKRPPSAFFIFCGDYRPKIKGENPGLT IGDIAKKLGEMWNSSSAEVKQPYEKKAAKLKEKYDKDIAAYRTKGIAGLSKSDPGDEDEE DEEDDDEDEDDDDEDDDE NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atggtgaaggatccgaggaagcccagaggaaaaatgtcctcttatgcgtattttgtgcaa acctgccgtgaggagcacaagaaaaagcacccggatgcttctgtcaacttctcggaattt tccaagaagtgctcagagcgatggaagacaatgtcacccaaggagaagagcaagtttgag gatatggccaagcaggataaggtccgttatgagagagaaatgaagaactacatccctccc aagggggagaagaagaagcgcttcaaggaccccaatgcccctaagagacctccgtcagcg ttcttcattttctgtggcgactatcgccccaagatcaagggtgagaatccaggcctgact attggagacattgccaagaagcttggagagatgtggaacagctcatcagcagaggtgaag cagccttatgagaagaaagctgccaagttgaaggagaagtatgacaaggatattgcggca taccgcacaaagggaattgcaggcctgtccaaatcagatcctggtgatgaagatgaggag gatgaggaagacgatgatgaggacgaggacgacgatgatgaggatgacgatgaatag

DBGET integrated database retrieval system