Silurus meridionalis (southern catfish): 124398941 Help Entry 124398941         CDS       T08004                                  Symbol cdc42l2 Name (RefSeq) cell division cycle 42 like 2   KO K04393   cell division control protein 42 Organism smeo  Silurus meridionalis (southern catfish) Pathway smeo04010   MAPK signaling pathway smeo04144   Endocytosis smeo04370   VEGF signaling pathway smeo04510   Focal adhesion smeo04520   Adherens junction smeo04530   Tight junction smeo04810   Regulation of actin cytoskeleton smeo04912   GnRH signaling pathway smeo05100   Bacterial invasion of epithelial cells smeo05132   Salmonella infection Brite KEGG Orthology (KO) [BR:smeo00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     124398941 (cdc42l2)    04370 VEGF signaling pathway     124398941 (cdc42l2)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     124398941 (cdc42l2)   09144 Cellular community - eukaryotes    04510 Focal adhesion     124398941 (cdc42l2)    04520 Adherens junction     124398941 (cdc42l2)    04530 Tight junction     124398941 (cdc42l2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     124398941 (cdc42l2)  09150 Organismal Systems   09152 Endocrine system    04912 GnRH signaling pathway     124398941 (cdc42l2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     124398941 (cdc42l2)    05100 Bacterial invasion of epithelial cells     124398941 (cdc42l2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:smeo04131]     124398941 (cdc42l2)    03036 Chromosome and associated proteins [BR:smeo03036]     124398941 (cdc42l2)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:smeo04147]     124398941 (cdc42l2)    04031 GTP-binding proteins [BR:smeo04031]     124398941 (cdc42l2) Membrane trafficking [BR:smeo04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     124398941 (cdc42l2)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     124398941 (cdc42l2)   Macropinocytosis    Ras GTPases     124398941 (cdc42l2) Chromosome and associated proteins [BR:smeo03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     124398941 (cdc42l2) Exosome [BR:smeo04147]  Exosomal proteins   Exosomal proteins of microglial cells    124398941 (cdc42l2)   Exosomal proteins of breast milk    124398941 (cdc42l2) GTP-binding proteins [BR:smeo04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     124398941 (cdc42l2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  124398941 NCBI-ProteinID:  XP_046725440 LinkDB All DBs Position 16:complement(8072830..8082088) Genome browser AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR DDPSTTEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP EPKKKPKCVLL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagacaattaaatgtgtagtagttggtgatggtgctgtgggtaaaacctgcctcttg atttcatacaccacaaacaagttcccttcggagtacgtaccaacagtgtttgataactat gctgtgaccgtaatgattggcggtgaaccgtacactctcggattatttgacactgcaggt caggaagattacgatcggttgcgacccttgagctacccccaaactgatgtcttcttagtt tgtttctctgtggtttcaccatcatcctttgaaaatgtcaaggaaaagtgggtgcctgag attacccatcactgtccaaagaccccgttcctgttggttgggacacagattgacctacga gacgatccctcaaccaccgagaagcttgccaagaacaagcagaagcccatcactccagag acagccgagaaactcgccagagatttaaaagcggtgaaatacgtggaatgttctgctcta acacaaaaagggctaaagaacgtattcgacgaggccatactcgctgcactggagcctcca gagcccaagaagaagcctaaatgtgttcttttatga

DBGET integrated database retrieval system