Silurus meridionalis (southern catfish): 124400200 Help Entry 124400200         CDS       T08004                                  Symbol rab7b Name (RefSeq) ras-related protein Rab-7b   KO K07897   Ras-related protein Rab-7A Organism smeo  Silurus meridionalis (southern catfish) Pathway smeo04137   Mitophagy - animal smeo04140   Autophagy - animal smeo04144   Endocytosis smeo04145   Phagosome smeo04148   Efferocytosis smeo05132   Salmonella infection Brite KEGG Orthology (KO) [BR:smeo00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     124400200 (rab7b)    04145 Phagosome     124400200 (rab7b)    04140 Autophagy - animal     124400200 (rab7b)    04137 Mitophagy - animal     124400200 (rab7b)    04148 Efferocytosis     124400200 (rab7b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     124400200 (rab7b)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:smeo04131]     124400200 (rab7b)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:smeo04147]     124400200 (rab7b)    04031 GTP-binding proteins [BR:smeo04031]     124400200 (rab7b) Membrane trafficking [BR:smeo04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     124400200 (rab7b) Exosome [BR:smeo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    124400200 (rab7b)   Exosomal proteins of other body fluids (saliva and urine)    124400200 (rab7b)   Exosomal proteins of colorectal cancer cells    124400200 (rab7b)   Exosomal proteins of bladder cancer cells    124400200 (rab7b) GTP-binding proteins [BR:smeo04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     124400200 (rab7b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA RsgA_GTPase cobW ATP_bind_1 PduV-EutP nSTAND3 Septin AAA_16 AAA_7 AAA_22 NTPase_1 AAA_24 G-alpha ATPase_2 AAA_5 ATP-synt_ab SRPRB NACHT MCM AAA_14 DAP3 Motif Other DBs NCBI-GeneID:  124400200 NCBI-ProteinID:  XP_046727824 LinkDB All DBs Position 17:3801802..3811894 Genome browser AA seq 206 aa AA seqDB search MASRKKVLLKVIILGDSGVGKTSLMNQYVNNKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVYDVTSPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKMDLENRQVTTKRAQAWCQSKNNIPYFETSAKEGINVDQAFQTIARNALKQENAG DPSPDFPEPIKLRDEKPANPNDICSC NT seq 621 nt NT seq  +upstreamnt  +downstreamnt atggcctctcgcaagaaggtgctgcttaaggtgatcatccttggagattctggggttgga aagacttctctaatgaaccagtatgtcaataacaagtttagcaaccagtacaaggccacg atcggcgccgactttttgaccaaagaggtgatggtggacgacaggctggtcaccatgcag atttgggacacggccggccaggaacgttttcagtctctgggcgtggcgttctacaggggc gccgactgctgcgtgctggtctacgacgtcacttctccaaacacctttaagactctggac agctggagggatgagttcctgatccaagccagccctcgcgaccccgagaacttcccattt gtcgtgctcggaaacaagatggacttggagaacagacaggttactacaaaacgagcccag gcctggtgtcaaagcaagaacaacatcccgtattttgagaccagcgccaaagaagggatc aacgtggaccaggcgttccaaaccatcgctcgcaatgcactcaaacaggagaatgcaggg gacccgagcccggactttccagaaccgatcaagctaagagacgagaaacctgcaaacccg aacgatatctgcagctgctga

DBGET integrated database retrieval system