Sulfuracidifex metallicus: RQ359_000409 Help Entry RQ359_000409      CDS       T09529                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism smet  Sulfuracidifex metallicus Pathway smet03010   Ribosome Brite KEGG Orthology (KO) [BR:smet00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     RQ359_000409   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     RQ359_000409  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:smet03011]     RQ359_000409    04121 Ubiquitin system [BR:smet04121]     RQ359_000409   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:smet04147]     RQ359_000409 Ribosome [BR:smet03011]  Ribosomal proteins   Eukaryotes    Small subunit     RQ359_000409   Archaea     RQ359_000409 Ubiquitin system [BR:smet04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    RQ359_000409 Exosome [BR:smet04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    RQ359_000409   Exosomal proteins of colorectal cancer cells    RQ359_000409 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_IS1595 Cas12f1-like_TNB Zn_ribbon_SprT TackOD1 Med16_C Zn_ribbon_RPB9 Zn_ribbon_Nudix YhfH Zn_Ribbon_1 UPF0547 FlhC Motif Other DBs NCBI-ProteinID:  WOE51153 LinkDB All DBs Position 344906..345100 Genome browser AA seq 64 aa AA seqDB search MANKKEGGSKAVVRLYYEVQGEEIKLKNKKCPRCGSIMAHHMKPVERWSCGKCKYTEYVG RKGK NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atggctaacaaaaaggaaggaggatctaaagccgtagttaggctttattatgaagttcaa ggtgaagaaataaaactaaagaacaagaagtgccccagatgcggtagcataatggcgcat cacatgaaacccgttgaaagatggtcttgcggaaaatgtaaatatactgaatatgtaggt aggaaaggtaagtaa

DBGET integrated database retrieval system