Sinorhizobium meliloti Rm41: BN406_04189 Help Entry BN406_04189       CDS       T02332                                  Name (GenBank) unnamed protein product   KO K04078   chaperonin GroES Organism smi  Sinorhizobium meliloti Rm41 Brite KEGG Orthology (KO) [BR:smi00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:smi03110]     BN406_04189    03029 Mitochondrial biogenesis [BR:smi03029]     BN406_04189 Chaperones and folding catalysts [BR:smi03110]  Heat shock proteins   HSP10    BN406_04189 Mitochondrial biogenesis [BR:smi03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     BN406_04189 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  CCM70471 LinkDB All DBs Position pSYMA:complement(684298..684465) Genome browser AA seq 55 aa AA seqDB search MAVGSGARDESGKVVPLDVKAGDRILFGKWSGTEVKINGEDLLIMKEADIMGVIG NT seq 168 nt NT seq  +upstreamnt  +downstreamnt gtggctgtcggttcgggtgcccgtgacgaaagcggcaaggttgttccgctcgacgtgaag gctggcgaccgcatcctgttcggcaagtggtccggcaccgaagtcaagatcaacggcgaa gaccttctgatcatgaaggaagccgacatcatgggtgtcatcggctga

DBGET integrated database retrieval system