Sinorhizobium meliloti Rm41: BN406_06019 Help Entry BN406_06019       CDS       T02332                                  Name (GenBank) unnamed protein product   KO K02078   acyl carrier protein Organism smi  Sinorhizobium meliloti Rm41 Pathway smi01100   Metabolic pathways smi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:smi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BN406_06019    00074 Mycolic acid biosynthesis     BN406_06019   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BN406_06019 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  CCM72301 LinkDB All DBs Position pSYMB:1033175..1033426 Genome browser AA seq 83 aa AA seqDB search MSDHQLYLSQVADVIRELFDEYDGPITLETTARDVPQWDSLSNVRLMVLIEQELAVRFST AEVQGFKNLGSLIDAVVKRKQNQ NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgtctgaccatcaactttatctatcccaagtcgcagacgtgatccgtgagctgttcgat gaatacgacggcccgattacgctggagacgacggcccgcgacgttccgcaatgggacagc ctgtccaacgtcagactgatggttctgatcgagcaggagctcgcagtccgcttcagcacg gcggaggtgcaaggtttcaagaacctcggcagccttatcgatgccgtggtcaagcgcaag cagaaccaatag

DBGET integrated database retrieval system