Sinorhizobium meliloti Rm41: BN406_06109 Help Entry BN406_06109       CDS       T02332                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism smi  Sinorhizobium meliloti Rm41 Pathway smi01100   Metabolic pathways smi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:smi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BN406_06109    00074 Mycolic acid biosynthesis     BN406_06109   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BN406_06109 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  CCM72391 LinkDB All DBs Position pSYMB:complement(1136460..1136723) Genome browser AA seq 87 aa AA seqDB search MNSSTSTLDEVKDIIIQTLGIEDASRIADASTPLFGSIPELDSFAVLNLAMAIESRFGFE IDDSEFTAEVFETVGSLAGYVDCNRRQ NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgaactcaagcacatcaacactcgacgaggtgaaggacatcatcattcagacgcttggt atagaagacgcaagcaggattgcggacgcttcgacacccttgttcggtagtatacccgag ctggactcatttgctgtactcaacctggccatggcgatcgaatcgcggttcggattcgag atcgatgatagcgagtttacggctgaagtcttcgagaccgtgggatcgcttgccggatac gtcgactgcaatcgccgtcagtag

DBGET integrated database retrieval system