Streptomyces mirabilis: SMIR_18350 Help Entry SMIR_18350        CDS       T10322                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism smib  Streptomyces mirabilis Pathway smib00253   Tetracycline biosynthesis smib01056   Biosynthesis of type II polyketide backbone smib01100   Metabolic pathways smib01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:smib00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     SMIR_18350    00253 Tetracycline biosynthesis     SMIR_18350  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:smib01004]     SMIR_18350    01008 Polyketide biosynthesis proteins [BR:smib01008]     SMIR_18350 Lipid biosynthesis proteins [BR:smib01004]  Polyketide synthase   Component type    SMIR_18350 Polyketide biosynthesis proteins [BR:smib01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      SMIR_18350     Nonaketide PKS      SMIR_18350     Decaketide PKS      SMIR_18350 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QUW80843 LinkDB All DBs Position complement(4160767..4161042) Genome browser AA seq 91 aa AA seqDB search MSTSEFTLDDLRRILQEGAGVDEGVDLDGDILDEPFEVLGYESLALLETGSRIEREYGIV LDEDLLTDADTPRALIEAVNQQFGADEPAAA NT seq 276 nt NT seq  +upstreamnt  +downstreamnt gtgtccacttcggaattcaccctggacgacctgcgccgcatcctccaggagggcgccggc gtcgacgagggcgtcgacctcgacggcgacatcctcgacgagccgttcgaagtcctcggc tacgagtcgctggcgctcctggagaccggcagccgtatagagcgcgagtacgggatcgtc ctcgacgaggacctgctgaccgacgccgacaccccgcgcgccctcatcgaggccgtgaac cagcagttcggcgccgacgagcccgccgccgcctga

DBGET integrated database retrieval system