Sphingosinicella microcystinivorans: SmB9_03260 Help Entry SmB9_03260        CDS       T05811                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism smic  Sphingosinicella microcystinivorans Pathway smic01100   Metabolic pathways smic01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:smic00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SmB9_03260 (acpP)    00074 Mycolic acid biosynthesis     SmB9_03260 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SmB9_03260 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF1493 Motif Other DBs NCBI-ProteinID:  BBE32668 UniProt:  A0AAD1FZE2 LinkDB All DBs Position complement(346790..347029) Genome browser AA seq 79 aa AA seqDB search MSDVAERVKKIVVEHLGVEPDKVTEDASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA EKILTVKDAIGYIEENSAA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatgtcgcagaacgtgtgaagaagatcgtcgtcgaacacctcggcgtcgagccg gacaaggtgaccgaggacgcgagcttcatcgacgatctcggcgcggacagcctcgacacc gtcgagctggtgatggcgttcgaggaagagttcggggtcgaaatccctgatgatgctgcc gagaagatcctcaccgtcaaggacgcgatcggctacatcgaggaaaacagcgccgcctga

DBGET integrated database retrieval system