Sphingosinicella microcystinivorans: SmB9_04110 Help Entry SmB9_04110        CDS       T05811                                  Name (GenBank) hypothetical protein   KO K03602   exodeoxyribonuclease VII small subunit [EC:3.1.11.6] Organism smic  Sphingosinicella microcystinivorans Pathway smic03430   Mismatch repair Brite KEGG Orthology (KO) [BR:smic00001]  09120 Genetic Information Processing   09124 Replication and repair    03430 Mismatch repair     SmB9_04110  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:smic03400]     SmB9_04110 Enzymes [BR:smic01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters     3.1.11.6  exodeoxyribonuclease VII      SmB9_04110 DNA repair and recombination proteins [BR:smic03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA exonucleases      SmB9_04110 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Exonuc_VII_S NBAS_11th Motif Other DBs NCBI-ProteinID:  BBE32753 UniProt:  A0AAD1D2V8 LinkDB All DBs Position complement(432637..432900) Genome browser AA seq 87 aa AA seqDB search MGSEMTGVDTASLEGLSFEAALARLEKIVHQLEAGEVDLEASIGLYEQGQQLKAFCESKL KAAQARIELIQIGPDGEPKGTRPFDTE NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggggagtgagatgaccggcgtggacacggcatcgctggaggggctgagctttgaagcc gcgctcgcgcggcttgagaagatcgtgcaccagctcgaagccggtgaagtcgatctcgaa gcctcgatcggactctatgaacagggccagcagttgaaggccttttgcgaatcgaagctg aaggcggcgcaggcgcgcatcgagcttatccagatcggccccgacggcgaaccgaagggc acgcgacccttcgataccgaatag

DBGET integrated database retrieval system