Sphingosinicella microcystinivorans: SmB9_23110 Help Entry SmB9_23110        CDS       T05811                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism smic  Sphingosinicella microcystinivorans Pathway smic00190   Oxidative phosphorylation smic01100   Metabolic pathways Module smic_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:smic00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     SmB9_23110  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:smic00194]     SmB9_23110 Photosynthesis proteins [BR:smic00194]  Photosystem and electron transport system   F-type ATPase [OT]    SmB9_23110 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  BBE34653 UniProt:  A0AAD1D760 LinkDB All DBs Position 2444527..2444751 Genome browser AA seq 74 aa AA seqDB search MDIASAKLIGAGLAAVGAGIAAIGVGTIFGQFLQGALRNPAAADKLGGRLIFGFAVTEAL GLIAAVVALALAFG NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggatatcgcatcagccaagctcatcggtgccggtctcgctgctgtcggcgcgggcatt gccgctatcggcgtgggcacgatcttcggccagttcctgcagggtgcgctgcgcaacccg gctgctgccgacaagctcggcggtcgtctgatcttcggcttcgcggtgaccgaggctctc ggcctcatcgccgccgtcgtcgcgctcgcgctcgcgttcggttga

DBGET integrated database retrieval system