Salvia miltiorrhiza (redroot sage): 130987744 Help Entry 130987744         CDS       T09291                                  Name (RefSeq) calmodulin-7   KO K02183   calmodulin Organism smil  Salvia miltiorrhiza (redroot sage) Pathway smil04016   MAPK signaling pathway - plant smil04070   Phosphatidylinositol signaling system smil04075   Plant hormone signal transduction smil04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:smil00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     130987744    04070 Phosphatidylinositol signaling system     130987744    04075 Plant hormone signal transduction     130987744  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     130987744  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:smil01009]     130987744   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:smil04131]     130987744    03036 Chromosome and associated proteins [BR:smil03036]     130987744   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:smil04147]     130987744 Protein phosphatases and associated proteins [BR:smil01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      130987744 Membrane trafficking [BR:smil04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     130987744 Chromosome and associated proteins [BR:smil03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      130987744 Exosome [BR:smil04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    130987744 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 UPF0154 DUF5580_M Dockerin_1 EFhand_Ca_insen RNA_pol_Rpb4 Caleosin MotA_activ FCaBP_EF-hand SPEF2_C SurA_N_3 PA_Ig-like Fe_hyd_lg_C DUF6279 PhageMin_Tail MecA_N Motif Other DBs NCBI-GeneID:  130987744 NCBI-ProteinID:  XP_057767378 LinkDB All DBs Position 6:1364534..1366896 Genome browser AA seq 149 aa AA seqDB search MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYEEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcggatcagttgacggacgatcagatctctgagttcaaggaggccttcagcctcttc gataaggatggcgatggttgcatcacgacgaaggagctgggtactgtgatgagatcccta ggtcagaacccgaccgaggctgagcttcaggatatgatcaacgaggtcgatgctgacggg aatgggaccatcgacttcccggagttcttgaacctcatggctaggaagatgaaggacacc gactctgaggaggagcttaaagaggcgttccgtgtgttcgacaaggaccagaacggcttc atctctgctgctgagctgcgccacgtgatgacgaatctgggcgagaagctgaccgacgag gaggtagatgagatgatcagggaggcggacgtcgacggcgacggccaaatcaactacgaa gagtttgttaaggttatgatggccaagtaa

DBGET integrated database retrieval system