Salvia miltiorrhiza (redroot sage): 130987978 Help Entry 130987978         CDS       T09291                                  Name (RefSeq) protein MHF1 homolog   KO K11511   centromere protein S Organism smil  Salvia miltiorrhiza (redroot sage) Pathway smil03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:smil00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     130987978  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:smil03036]     130987978    03400 DNA repair and recombination proteins [BR:smil03400]     130987978 Chromosome and associated proteins [BR:smil03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      130987978 DNA repair and recombination proteins [BR:smil03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      130987978 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-S CENP-T_C Bromo_TP TFIID-31kDa Eap1 DUF1175 Motif Other DBs NCBI-GeneID:  130987978 NCBI-ProteinID:  XP_057767694 LinkDB All DBs Position 6:3505363..3508551 Genome browser AA seq 135 aa AA seqDB search MASDVERGEEEEEESASEELRDRFRLCTISIAETEAKRNGMEISQPIMACVSDLAFKYAK QLAKDLELFAQHAGRKSVNMEDVILSAHRNDHLSASLRSFSNDLKAKEPQSDRKRKKVTK KEDKAAKEVLHIADS NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atggcgagcgatgtggagcgaggggaagaagaagaggaagaatcggccagcgaggagttg agggatcgattccgcctctgtaccatctccatcgccgaaactgaagcgaagcgaaacggc atggaaatttcccagccaataatggcgtgtgtctccgatttagccttcaaatatgctaaa cagttggcaaaagaccttgagttgtttgcacagcatgctggtcgcaagtctgtgaacatg gaagacgtcatactttctgctcatcgcaatgatcatctatctgcatcgttgaggtcgttc tccaatgatctaaaagcgaaagaacctcaatctgatcgcaagagaaagaaggtcacaaaa aaagaagacaaagctgctaaagaagtgctccatattgctgattcctaa

DBGET integrated database retrieval system