KEGG   Salvia miltiorrhiza (redroot sage): 130989297
Entry
130989297         CDS       T09291                                 
Name
(RefSeq) SKP1-like protein 1A
  KO
K03094  S-phase kinase-associated protein 1
Organism
smil  Salvia miltiorrhiza (redroot sage)
Pathway
smil03083  Polycomb repressive complex
smil04120  Ubiquitin mediated proteolysis
smil04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:smil00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    130989297
   04120 Ubiquitin mediated proteolysis
    130989297
  09126 Chromosome
   03083 Polycomb repressive complex
    130989297
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:smil04131]
    130989297
   04121 Ubiquitin system [BR:smil04121]
    130989297
   03036 Chromosome and associated proteins [BR:smil03036]
    130989297
Membrane trafficking [BR:smil04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    130989297
Ubiquitin system [BR:smil04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   SCF complex
    Adaptor protein
     130989297
   Cul7 complex
     130989297
Chromosome and associated proteins [BR:smil03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.1)
     130989297
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     130989297
SSDB
Motif
Pfam: Skp1 Skp1_POZ Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 130989297
NCBI-ProteinID: XP_057769242
LinkDB
Position
6:complement(35875595..35877616)
AA seq 165 aa
MSGADAASGKMIVLQSSDNETFVVEEAVAVESQTIKHMIEDDCADTSIPLPNVTSKILAK
VIEYCRRHVEAAAKATGDGASLGGDEDLKSFDAEFVKVDQGTLFDLILAANYLNIKSLLD
LTCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENAWAFE
NT seq 498 nt   +upstreamnt  +downstreamnt
atgtctggcgcagacgccgcgtctgggaagatgatcgtgctgcagagctccgacaacgag
accttcgtggtggaggaggcggtcgccgtggaatcgcagacgattaagcacatgatcgag
gacgactgcgccgacaccagcatcccgcttcccaacgtcacatcgaagatcctcgcgaag
gttatcgagtactgtaggcgccacgtggaagccgccgctaaggccaccggagacggcgcc
tcgctgggcggcgatgaggacctcaagtcatttgatgctgagttcgtgaaggttgatcag
gggacgctcttcgacctcattctggctgcaaactacctcaacatcaagagccttctcgac
cttacatgccaaactgtggcggatatgatcaagggcaagaccccagaggaaatccgcaag
actttcaacataaagaatgacttcacccctgaggaggaagaagaggttcgtcgtgagaat
gcttgggcctttgagtga

DBGET integrated database retrieval system