Salvia miltiorrhiza (redroot sage): 131000639 Help Entry 131000639         CDS       T09291                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism smil  Salvia miltiorrhiza (redroot sage) Brite KEGG Orthology (KO) [BR:smil00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:smil03041]     131000639   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:smil04052]     131000639 Spliceosome [BR:smil03041]  Complex B   Other components    Complex B specific factors     131000639 Cytokines and neuropeptides [BR:smil04052]  Neuropeptides   Unclassified    131000639 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 OTU1_UBXL Rad60-SLD Ubiquitin_4 Motif Other DBs NCBI-GeneID:  131000639 NCBI-ProteinID:  XP_057782628 LinkDB All DBs Position 8:complement(8052480..8053952) Genome browser AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVRVKCNDDDTIGDLKKLVAAQTGTRADKIRIQKWYTVYKDHITLKDY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgattgaggtggtgttgaacgatcggctggggaagaaggttcgggtgaaatgcaacgac gacgacacgattggcgacctgaagaagctggtggcggctcagacgggaacgcgcgctgac aagatcagaatccagaaatggtacaccgtctataaggaccacatcaccctaaaggactac gagatccacgacggcatgggcctcgagctctactacaactag

DBGET integrated database retrieval system