Salvia miltiorrhiza (redroot sage): 131001056 Help Entry 131001056         CDS       T09291                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism smil  Salvia miltiorrhiza (redroot sage) Pathway smil04145   Phagosome smil04148   Efferocytosis smil04620   Toll-like receptor signaling pathway smil05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:smil00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     131001056    04148 Efferocytosis     131001056  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     131001056  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     131001056  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:smil04131]     131001056   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:smil04147]     131001056    04031 GTP-binding proteins [BR:smil04031]     131001056 Membrane trafficking [BR:smil04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     131001056  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     131001056   Macropinocytosis    Ras GTPases     131001056  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     131001056 Exosome [BR:smil04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    131001056   Exosomal proteins of other body fluids (saliva and urine)    131001056   Exosomal proteins of colorectal cancer cells    131001056   Exosomal proteins of bladder cancer cells    131001056 GTP-binding proteins [BR:smil04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     131001056 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf Motif Other DBs NCBI-GeneID:  131001056 NCBI-ProteinID:  XP_057783217 LinkDB All DBs Position 8:12239869..12243892 Genome browser AA seq 198 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELRHYAPGVPIILVGTKL DLREDKQFFVDHPGAVPITTAQGEDLKKSIGAAAYIECSAKTQQNVKAVFDAAIKVVLQP PKQKKKKKRKGQKACSIL NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgagcgcgtctagatttattaagtgcgtgaccgtgggcgacggagctgtgggtaaaact tgcttgctcatctcttacactagcaatacttttccaactgattatgtcccaactgttttt gataatttcagtgccaatgtcgtagtggacggtagcactgttaatctaggattgtgggat actgcaggccaagaggattacaatagattgagaccattgagctaccgtggggctgatgtc tttattctcgccttctctcttattagcaaggctagttacgagaatgtctccaagaagtgg attcctgaattgaggcattatgctcctggagttccaataatccttgtggggacaaagctt gatcttcgagaggataagcagttcttcgtggaccaccctggagcagttcccatcacgaca gcacagggagaggacttgaagaaatcgattggagctgctgcttacattgaatgcagtgct aagacacaacagaatgtgaaggctgtctttgatgcagcaattaaggtggttctgcagcca cccaagcaaaagaagaaaaagaagagaaagggccaaaaagcatgcagcatattataa

DBGET integrated database retrieval system