Salvia miltiorrhiza (redroot sage): 131004488 Help Entry 131004488         CDS       T09291                                  Name (RefSeq) sm-like protein LSM2   KO K12621   U6 snRNA-associated Sm-like protein LSm2 Organism smil  Salvia miltiorrhiza (redroot sage) Pathway smil03018   RNA degradation smil03040   Spliceosome Brite KEGG Orthology (KO) [BR:smil00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     131004488   09123 Folding, sorting and degradation    03018 RNA degradation     131004488  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:smil03019]     131004488    03041 Spliceosome [BR:smil03041]     131004488 Messenger RNA biogenesis [BR:smil03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      131004488   mRNA degradation factors    5'-3' decay     Lsm complex      131004488 Spliceosome [BR:smil03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     131004488  Complex C   U2 snRNP components     131004488 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM SM-ATX DUF150_C LSM14 Motif Other DBs NCBI-GeneID:  131004488 NCBI-ProteinID:  XP_057787168 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search MLFFSYFKDLVGREVTVELKNDLAIRGTLHSVDQYLNIKLENTRVVDQDKYPHMLSVRNC FFRGSVVRYVQLPPEGVDVELLHDATRREARGG NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgttgttcttctcgtatttcaaggatttggtggggagagaagtaacggtggaattgaag aacgatttagcgattagagggactctacattcagtggatcaatatctcaacattaagctg gagaatactagggttgttgatcaagacaagtacccccatatgctttcagtgcgaaactgc tttttccggggatctgtggtccgatatgtccaattgccacccgagggagttgatgtcgag cttctgcatgatgccaccagaagagaagcacgcggtggctaa

DBGET integrated database retrieval system