Salvia miltiorrhiza (redroot sage): 131011110 Help Entry 131011110         CDS       T09291                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism smil  Salvia miltiorrhiza (redroot sage) Pathway smil04145   Phagosome smil04148   Efferocytosis smil04517   IgSF CAM signaling smil04518   Integrin signaling smil04620   Toll-like receptor signaling pathway smil05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:smil00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     131011110    04518 Integrin signaling     131011110  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     131011110    04148 Efferocytosis     131011110  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     131011110  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     131011110  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:smil04131]     131011110   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:smil04147]     131011110    04031 GTP-binding proteins [BR:smil04031]     131011110 Membrane trafficking [BR:smil04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     131011110  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     131011110   Macropinocytosis    Ras GTPases     131011110  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     131011110 Exosome [BR:smil04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    131011110   Exosomal proteins of other body fluids (saliva and urine)    131011110   Exosomal proteins of colorectal cancer cells    131011110   Exosomal proteins of bladder cancer cells    131011110 GTP-binding proteins [BR:smil04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     131011110 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  131011110 NCBI-ProteinID:  XP_057794870 LinkDB All DBs Position 2:64199545..64203085 Genome browser AA seq 196 aa AA seqDB search MSATRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKL DLRDDKQFFIDHPGAVPITTAQGEELKKLIGAPAYIECSSKTQQNVKGVFDAAIKIVLQP PKQKKKRKGHRGCSIL NT seq 591 nt NT seq  +upstreamnt  +downstreamnt atgagtgcaacgagattcattaagtgtgtgactgtgggtgatggagctgttggaaaaact tgcatgttgatttcttacaccagcaacacatttcctacggattatgtcccgactgttttt gataacttcagtgctaatgtagttgtggatggtaatactgtaaacctgggactctgggat actgcaggtcaggaggattataacagattaagacccttgagttatcgtggagctgatgtt ttccttctagccttctctctcattagcaaggccagctacgaaaatattgcaaagaagtgg attccagagttgaggcattacgcaccaggtgttccaattattctcgttggaacgaagctt gatcttagagatgataagcagttcttcattgatcatcctggagcagttccaataactaca gctcagggggaggaactcaagaaacttattggagctcctgcatacattgagtgcagttca aaaacacaacagaatgtgaagggtgtgtttgatgcagccattaagatagtattgcagcca ccaaagcagaagaagaaaaggaaggggcacagaggctgctccattttgtaa

DBGET integrated database retrieval system