Salvia miltiorrhiza (redroot sage): 131011110 Help Entry 131011110         CDS       T09291                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism smil  Salvia miltiorrhiza (redroot sage) Pathway smil04145   Phagosome smil04148   Efferocytosis smil04620   Toll-like receptor signaling pathway smil05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:smil00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     131011110    04148 Efferocytosis     131011110  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     131011110  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     131011110  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:smil04131]     131011110   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:smil04147]     131011110    04031 GTP-binding proteins [BR:smil04031]     131011110 Membrane trafficking [BR:smil04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     131011110  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     131011110   Macropinocytosis    Ras GTPases     131011110  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     131011110 Exosome [BR:smil04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    131011110   Exosomal proteins of other body fluids (saliva and urine)    131011110   Exosomal proteins of colorectal cancer cells    131011110   Exosomal proteins of bladder cancer cells    131011110 GTP-binding proteins [BR:smil04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     131011110 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  131011110 NCBI-ProteinID:  XP_057794870 LinkDB All DBs Position 2:64199545..64203085 Genome browser AA seq 196 aa AA seqDB search MSATRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKL DLRDDKQFFIDHPGAVPITTAQGEELKKLIGAPAYIECSSKTQQNVKGVFDAAIKIVLQP PKQKKKRKGHRGCSIL NT seq 591 nt NT seq  +upstreamnt  +downstreamnt atgagtgcaacgagattcattaagtgtgtgactgtgggtgatggagctgttggaaaaact tgcatgttgatttcttacaccagcaacacatttcctacggattatgtcccgactgttttt gataacttcagtgctaatgtagttgtggatggtaatactgtaaacctgggactctgggat actgcaggtcaggaggattataacagattaagacccttgagttatcgtggagctgatgtt ttccttctagccttctctctcattagcaaggccagctacgaaaatattgcaaagaagtgg attccagagttgaggcattacgcaccaggtgttccaattattctcgttggaacgaagctt gatcttagagatgataagcagttcttcattgatcatcctggagcagttccaataactaca gctcagggggaggaactcaagaaacttattggagctcctgcatacattgagtgcagttca aaaacacaacagaatgtgaagggtgtgtttgatgcagccattaagatagtattgcagcca ccaaagcagaagaagaaaaggaaggggcacagaggctgctccattttgtaa

DBGET integrated database retrieval system