KEGG   Salvia miltiorrhiza (redroot sage): 131011123
Entry
131011123         CDS       T09291                                 
Name
(RefSeq) SKP1-like protein 1A
  KO
K03094  S-phase kinase-associated protein 1
Organism
smil  Salvia miltiorrhiza (redroot sage)
Pathway
smil03083  Polycomb repressive complex
smil04120  Ubiquitin mediated proteolysis
smil04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:smil00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    131011123
   04120 Ubiquitin mediated proteolysis
    131011123
  09126 Chromosome
   03083 Polycomb repressive complex
    131011123
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:smil04131]
    131011123
   04121 Ubiquitin system [BR:smil04121]
    131011123
   03036 Chromosome and associated proteins [BR:smil03036]
    131011123
Membrane trafficking [BR:smil04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    131011123
Ubiquitin system [BR:smil04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   SCF complex
    Adaptor protein
     131011123
   Cul7 complex
     131011123
Chromosome and associated proteins [BR:smil03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.1)
     131011123
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     131011123
SSDB
Motif
Pfam: Skp1 Skp1_POZ Ribosomal_L1
Other DBs
NCBI-GeneID: 131011123
NCBI-ProteinID: XP_057794887
LinkDB
Position
2:64337362..64339271
AA seq 169 aa
MSSSAAENGSRKITLRSSDGEVFEVDESVALESQTIKHMIEDDCVDNVIPLPNVTGKILS
KVIEYCKRHVDAAASATKADDKLASAVSDEELKAFDAEFVKVDQGTLFDLILAANYLNIK
TLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE
NT seq 510 nt   +upstreamnt  +downstreamnt
atgtcgtcgtccgcggcggagaacgggagcaggaagatcaccctgcgcagttccgacggc
gaggtgtttgaggtggacgagtcggtggccctggagtcgcagacgatcaagcacatgatc
gaggatgattgcgtcgacaacgtcatccctctccccaacgtcacgggaaaaatactttcc
aaagtcatcgaatactgcaagcgccacgtcgatgccgccgcttccgcaaccaaggccgat
gacaagctcgcttccgccgtctctgatgaggaacttaaggcttttgacgctgaatttgtc
aaagtcgaccaaggcacgcttttcgaccttattttggctgctaattacttgaatatcaag
acccttctggatctgacttgccagacggtcgctgacatgatcaagggaaaaactccagag
gagatcaggaagacattcaacatcaagaatgacttcacacctgaggaagaagaggaagtc
cggcgagagaaccaatgggcttttgaatag

DBGET integrated database retrieval system