Salvia miltiorrhiza (redroot sage): 131014821 Help Entry 131014821         CDS       T09291                                  Name (RefSeq) SKP1-like protein 11   KO K03094   S-phase kinase-associated protein 1 Organism smil  Salvia miltiorrhiza (redroot sage) Pathway smil03083   Polycomb repressive complex smil04120   Ubiquitin mediated proteolysis smil04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:smil00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     131014821    04120 Ubiquitin mediated proteolysis     131014821   09126 Chromosome    03083 Polycomb repressive complex     131014821  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:smil04131]     131014821    04121 Ubiquitin system [BR:smil04121]     131014821    03036 Chromosome and associated proteins [BR:smil03036]     131014821 Membrane trafficking [BR:smil04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     131014821 Ubiquitin system [BR:smil04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      131014821    Cul7 complex      131014821 Chromosome and associated proteins [BR:smil03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      131014821   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      131014821 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ Sororin Motif Other DBs NCBI-GeneID:  131014821 NCBI-ProteinID:  XP_057798900 LinkDB All DBs Position 3:complement(58688214..58688930) Genome browser AA seq 131 aa AA seqDB search MAEISAEERTLTLLSSDGERFMVPEAAAVQSKTIKNIVEDGCSGGPIPLANVSSKVLAEV IVFLKNHANGSEIEEQKKSDETFLKEIADRIRDKSPEWVRNLFGIENDYTPEEEEAVRME YAWAFDDINDD NT seq 396 nt NT seq  +upstreamnt  +downstreamnt atggccgaaatttcagcggaggaacgaaccctaactttattgagctccgacggcgaacgg ttcatggtccccgaagccgccgccgtgcaatcaaaaacgatcaagaatatcgtggaggat gggtgcagcggcggcccgatcccgctcgccaatgtcagctctaaagtactggctgaggtc atcgtcttccttaaaaatcacgcgaatggcagcgagatcgaggaacagaagaaaagcgac gagacattcctgaaggagatcgccgataggattcgagataaatcgccggagtgggtgagg aacctgttcggaatcgaaaacgattacacgccggaggaggaggaagcggtcaggatggaa tacgcgtgggcttttgacgatatcaatgatgattga

DBGET integrated database retrieval system