Salvia miltiorrhiza (redroot sage): 14676029 Help Entry 14676029          CDS       T09291                                  Symbol psbE, I565_pgp051 Name (RefSeq) photosystem II protein V   KO K02707   photosystem II cytochrome b559 subunit alpha Organism smil  Salvia miltiorrhiza (redroot sage) Pathway smil00195   Photosynthesis smil01100   Metabolic pathways Module smil_M00161   Photosystem II smil_M00611   Oxygenic photosynthesis in plants and cyanobacteria Brite KEGG Orthology (KO) [BR:smil00001]  09100 Metabolism   09102 Energy metabolism    00195 Photosynthesis     14676029 (psbE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:smil00194]     14676029 (psbE) Photosynthesis proteins [BR:smil00194]  Photosystem and electron transport system   Photosystem II (P680 chlorophyll a) [OT]    Main subunits     14676029 (psbE) SSDB OrthologParalogGFIT Motif Pfam:  Cytochrom_B559a Cytochrom_B559 Motif Other DBs NCBI-GeneID:  14676029 NCBI-ProteinID:  YP_007507128 UniProt:  M1FL76 LinkDB All DBs Position Pltd:complement(63764..64015) Genome browser AA seq 83 aa AA seqDB search MSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESR QGIPLITGRFDSLEQLDEFSRSF NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgtctggaagcacaggagaacgttcttttgctgatattattaccagtattcgatattgg gtcattcatagcattactataccttccctattcattgcgggttggttattcgtcagtacc ggtttagcttacgatgtatttggaagccctcggccaaacgagtatttcacagagagccga caaggaattccattaataactggccgttttgattctttggaacaactcgatgaatttagt agatcgttttag

DBGET integrated database retrieval system