Salvia miltiorrhiza (redroot sage): 18126348 Help Entry 18126348          CDS       T09291                                  Symbol nad4L, Salmi_Mp078 Name (RefSeq) NADH dehydrogenase subunit 4L   KO K03882   NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2] Organism smil  Salvia miltiorrhiza (redroot sage) Pathway smil00190   Oxidative phosphorylation smil01100   Metabolic pathways Module smil_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:smil00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     18126348 (nad4L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:smil03029]     18126348 (nad4L) Enzymes [BR:smil01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      18126348 (nad4L) Mitochondrial biogenesis [BR:smil03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     18126348 (nad4L) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Oxidored_q2 DUF1899 Motif Other DBs NCBI-GeneID:  18126348 NCBI-ProteinID:  YP_008992342 UniProt:  V9P4Z5 LinkDB All DBs Position MT:291809..292111 Genome browser AA seq 100 aa AA seqDB search MDPIKYFTFSMIISISGIRGILLNRRNIPIMSMPIESMLLAVNSNFLVFSVSSDDMMGQS FASLVSTVAAAESAIGLAIFVITFRVRGTIAVESINSIQG NT seq 303 nt NT seq  +upstreamnt  +downstreamnt acggatcctattaaatattttacattttctatgatcatctctatttcaggtattcgggga atcctccttaatagacgaaatattcctattatgtcaatgccaattgaatcaatgttatta gctgtgaattcgaactttttggtattttccgtttcttcggatgatatgatgggtcaatca tttgcttcattggtttcaacggtggcagctgcggaatctgctattgggttagccattttc gttattactttccgagtccgagggactattgctgtagaatctattaatagcattcaaggt taa

DBGET integrated database retrieval system