Sphaerotilus microaerophilus: CATMQ487_04200 Help Entry CATMQ487_04200    CDS       T10131                                  Name (GenBank) hypothetical protein   KO K16244   phenol/toluene 2-monooxygenase (NADH) P2/A2 [EC:1.14.13.244 1.14.13.243] Organism smio  Sphaerotilus microaerophilus Pathway smio00361   Chlorocyclohexane and chlorobenzene degradation smio00362   Benzoate degradation smio00623   Toluene degradation smio01100   Metabolic pathways smio01120   Microbial metabolism in diverse environments smio01220   Degradation of aromatic compounds Module smio_M00548   Benzene degradation, benzene => catechol Brite Enzymes [BR:smio01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.243  toluene 2-monooxygenase      CATMQ487_04200     1.14.13.244  phenol 2-monooxygenase (NADH)      CATMQ487_04200 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  BDI03450 LinkDB All DBs Position complement(463974..464243) Genome browser AA seq 89 aa AA seqDB search MSNVFIAFQKNEESRCIVEAILADNPAAVVNEQPAMVKVDVPGRMVIRRETVEEQMGRDF DLQELHVNLITMSGHVEETDDEFALSWKN NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtcgaacgtattcatcgcgttccagaagaacgaagagagccgctgcatcgtcgaggcc atcctggccgacaaccccgcggccgtggtcaacgagcagcccgccatggtcaaggtcgac gtgcctggccgcatggtgatccgccgcgagacggtggaagagcagatgggccgcgacttc gacctgcaggagctgcacgtcaacctgatcacgatgtccggtcacgtggaagagaccgac gacgagttcgccctttcctggaagaactga

DBGET integrated database retrieval system