Sphingobacterium mizutaii: 4412673_02854 Help Entry 4412673_02854     CDS       T05395                                  Symbol ssb_1 Name (GenBank) Helix-destabilizing protein   KO K03111   single-strand DNA-binding protein Organism smiz  Sphingobacterium mizutaii Pathway smiz03030   DNA replication smiz03430   Mismatch repair smiz03440   Homologous recombination Brite KEGG Orthology (KO) [BR:smiz00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     4412673_02854 (ssb_1)    03430 Mismatch repair     4412673_02854 (ssb_1)    03440 Homologous recombination     4412673_02854 (ssb_1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:smiz03032]     4412673_02854 (ssb_1)    03400 DNA repair and recombination proteins [BR:smiz03400]     4412673_02854 (ssb_1)    03029 Mitochondrial biogenesis [BR:smiz03029]     4412673_02854 (ssb_1) DNA replication proteins [BR:smiz03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     4412673_02854 (ssb_1) DNA repair and recombination proteins [BR:smiz03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     Other MMR factors      4412673_02854 (ssb_1)   TLS (translesion DNA synthesis) factors    Other SOS response factors     4412673_02854 (ssb_1) Mitochondrial biogenesis [BR:smiz03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA replication factors    Other Mitochondrial DNA replication factors     4412673_02854 (ssb_1) SSDB OrthologParalogGFIT Motif Pfam:  SSB OSB_SSB Motif Other DBs NCBI-ProteinID:  SNV53342 UniProt:  A0AAJ5C180 LinkDB All DBs Position 1:complement(3226414..3226791) Genome browser AA seq 125 aa AA seqDB search MSTIKNSVQLLGRLGQEAEIKISSTGIPFCFISLVTNEYGVKKNGEQYEKSQWHRIAVWG NMLCNQMKKRGKKGSLWLIQGTIFYKQFEKESGNTQQYCEIRANKLMFLMEGMGLNQKMQ PEISA NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atgagcacgataaaaaattcagtacaactattgggaaggttaggtcaggaagcagagatc aagatcagcagcactggtataccattctgttttatttctttggtcactaatgaatacggg gtcaagaagaatggtgaacagtatgagaaaagtcaatggcatcggatagcggtatggggc aatatgctgtgcaatcaaatgaagaaacgcggtaaaaaaggtagtctttggttgatccaa ggaactattttctacaaacaattcgaaaaggaaagcggcaatacacaacagtattgtgaa atcagggcaaataagttgatgtttctgatggaagggatggggctgaaccagaagatgcaa cctgaaatcagcgcgtag

DBGET integrated database retrieval system