Stenotrophomonas maltophilia K279a: Smlt4570 Help Entry Smlt4570          CDS       T00718                                  Symbol acpP Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism sml  Stenotrophomonas maltophilia K279a Pathway sml01100   Metabolic pathways sml01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sml00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Smlt4570 (acpP)    00074 Mycolic acid biosynthesis     Smlt4570 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Smlt4570 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 TRAF_BIRC3_bd Motif Other DBs NCBI-ProteinID:  CAQ47925 UniProt:  B2FNB4 LinkDB All DBs Position complement(4692790..4693047) Genome browser AA seq 85 aa AA seqDB search MTKNELFERIVSILTDSFEIETARITPEARLYDDLDIDSIDAVDLIVQLKPLLGRNLQPE AFKAVRTVQDIVDVVHGLLPDQAAA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgaccaagaatgaactgttcgaacgcatcgtcagcatcctgaccgacagcttcgagatc gaaaccgcccggatcacccccgaggcacgcctgtacgacgacctggatatcgacagcatc gatgcggtcgacctgatcgtgcagctcaagccgctgctgggccgcaatctgcagccggaa gcgttcaaggccgtgcgcaccgtgcaggacatcgtcgatgtcgtgcatgggttgctgccg gaccaggcagccgcctga

DBGET integrated database retrieval system