Stenotrophomonas maltophilia K279a: Smlt4571 Help Entry Smlt4571          CDS       T00718                                  Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism sml  Stenotrophomonas maltophilia K279a Pathway sml01100   Metabolic pathways sml01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sml00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Smlt4571    00074 Mycolic acid biosynthesis     Smlt4571   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Smlt4571 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  CAQ47926 UniProt:  B2FNB5 LinkDB All DBs Position complement(4693065..4693322) Genome browser AA seq 85 aa AA seqDB search MQALEHEIKELIISSLSLEDITPEDIDPTAPLFVEGLGLDSIDALELGLALQKKYGVSLS ADSEETRRHFSSVRALGEFVAARQS NT seq 258 nt NT seq  +upstreamnt  +downstreamnt gtgcaagcacttgagcacgagatcaaggaattgatcatttcctccctttcgctggaggac atcacgccggaggacatcgatccgaccgcgccgctgttcgtcgagggcctcggcctggat tcgatcgacgcgctggagctgggcctggcgctgcagaagaagtacggtgtcagcctctcg gccgattcggaagaaacccgtcgccatttctccagcgtgcgcgcgctcggcgagttcgtc gccgcccgccagtcgtaa

DBGET integrated database retrieval system