Schistosoma mansoni: Smp_017280 Help Entry Smp_017280        CDS       T01095                                  Name (RefSeq) putative ubiquitin   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism smm  Schistosoma mansoni Pathway smm03010   Ribosome smm04120   Ubiquitin mediated proteolysis smm04137   Mitophagy - animal smm04140   Autophagy - animal Brite KEGG Orthology (KO) [BR:smm00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Smp_017280   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Smp_017280  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     Smp_017280    04137 Mitophagy - animal     Smp_017280  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:smm03011]     Smp_017280    04121 Ubiquitin system [BR:smm04121]     Smp_017280   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:smm04147]     Smp_017280 Ribosome [BR:smm03011]  Ribosomal proteins   Eukaryotes    Small subunit     Smp_017280   Archaea     Smp_017280 Ubiquitin system [BR:smm04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Smp_017280 Exosome [BR:smm04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Smp_017280   Exosomal proteins of colorectal cancer cells    Smp_017280 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 ubiquitin Rad60-SLD Ubiquitin_2 OTU1_UBXL Motif Other DBs NCBI-GeneID:  8350749 NCBI-ProteinID:  XP_018650649 UniProt:  Q15ER5 LinkDB All DBs Position 2:33776525..33777098 Genome browser AA seq 153 aa AA seqDB search MRLFIRSHLHDQVVISAGPNESVRSLKDKISLVTGIQATTQSLYHHGSPLLDCALLQDFG ITDLDYVDVNCELRGGGKKRKKKNYTTPKKIKHKKKKVKLATLKFYKVDSNGKVTRLRRE CPNDKCGAGVFMASHFDREYCGKCTLTYKHVNK NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgaggttgtttattcgatcccaccttcatgaccaggttgtgatatctgcgggaccaaat gagtccgtgaggtcattaaaagataaaatttctctggtcaccggcatacaggctactact cagtccctttatcatcatggctctcctttactcgattgtgcacttctacaagattttggt atcaccgacctagattatgtcgacgtaaattgtgaacttcgaggtggaggaaagaagaga aaaaagaaaaattacaccactccaaagaagatcaagcacaagaagaaaaaagtaaaactc gcgacgctgaagttttacaaagttgactcaaatggaaaggtaacgcggttacggagagaa tgtcccaacgataagtgcggtgcaggagtctttatggccagccactttgaccgtgaatat tgtgggaaatgtaccttaacatacaaacatgtgaataagtag

DBGET integrated database retrieval system