Schistosoma mansoni: Smp_056420 Help Entry Smp_056420        CDS       T01095                                  Name (RefSeq) putative histone H2A   KO K11251   histone H2A Organism smm  Schistosoma mansoni Pathway smm03082   ATP-dependent chromatin remodeling Brite KEGG Orthology (KO) [BR:smm00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     Smp_056420  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:smm03036]     Smp_056420   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:smm04147]     Smp_056420 Chromosome and associated proteins [BR:smm03036]  Eukaryotic type   Nucleosome assembly factors    Histones     Smp_056420 Exosome [BR:smm04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Smp_056420 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone Motif Other DBs NCBI-GeneID:  8355104 NCBI-ProteinID:  XP_018654490 LinkDB All DBs Position W:22654113..22654346 Genome browser AA seq 77 aa AA seqDB search MSGCGKGGKVRSKAKTRSEHAVLQFPVDRVHHLLRKDNYAERVGAGTAVYLAAEVLELAG NAAQDNKKTRIIPRHLH NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtggatgcggtaaaggtggcaaggttcgaagcaaggcaaagacaaggtcagagcac gccgttcttcagtttcccgtagatcgcgtacatcaccttttacgtaaggacaattacgct gagcgagttggggctggtactgcagtttatctggctgcagaagttttggagttagctggt aatgccgctcaagacaataagaagactcgtatcatcccgagacatttacactag

DBGET integrated database retrieval system