Schistosoma mansoni: Smp_062300.1 Help Entry Smp_062300.1      CDS       T01095                                  Name (RefSeq) putative rac gtpase   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism smm  Schistosoma mansoni Pathway smm04145   Phagosome smm04148   Efferocytosis smm04310   Wnt signaling pathway smm04620   Toll-like receptor signaling pathway smm05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:smm00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     Smp_062300.1  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     Smp_062300.1    04148 Efferocytosis     Smp_062300.1  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     Smp_062300.1  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     Smp_062300.1  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:smm04131]     Smp_062300.1   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:smm04147]     Smp_062300.1    04031 GTP-binding proteins [BR:smm04031]     Smp_062300.1 Membrane trafficking [BR:smm04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     Smp_062300.1  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     Smp_062300.1   Macropinocytosis    Ras GTPases     Smp_062300.1  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     Smp_062300.1 Exosome [BR:smm04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Smp_062300.1   Exosomal proteins of other body fluids (saliva and urine)    Smp_062300.1   Exosomal proteins of colorectal cancer cells    Smp_062300.1   Exosomal proteins of bladder cancer cells    Smp_062300.1 GTP-binding proteins [BR:smm04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     Smp_062300.1 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  8347113 NCBI-ProteinID:  XP_018653485 UniProt:  G4VMJ9 LinkDB All DBs Position 7:155230..159843 Genome browser AA seq 188 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYVPTVFDNYSANVMVDRKPVNLGLWDTAG QEDYDRLRPLSYPQTDVFLMCFSLVSRTSFENVRSKWYPEISAHVPNAPIILVGTKRDLR DSPNGLKSTMLPVTYSEGCRMAKEIKAVKYLECSALTQFGLKDVFDEAIRAVLMPEGKKK KHSSCELI NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atgcaagccatcaaatgtgtggttgtcggtgatggcgctgtcgggaagacctgtttactc attagctacacgacgaatgcctttcctggtgagtacgtcccaaccgttttcgataactat tctgccaacgtaatggttgaccgaaaacctgtgaaccttggtttgtgggatacagctggt caggaggattatgacagactaagaccactctcatatccacaaactgatgtgtttttgatg tgcttttccctagtcagtcgcacatcgttcgagaatgttcgtagcaaatggtatccggag atatccgcccatgttccaaatgctcctattattcttgtcggaactaaacgagaccttcgg gatagtcctaatggcctaaaatcaacaatgttaccggtaacctattcggagggttgcaga atggcaaaagaaattaaagctgtgaagtacctggaatgttctgctttaactcagttcgga ttaaaagatgtcttcgacgaagctattcgagcagtactgatgcctgaagggaagaaaaag aagcacagttcatgtgaattaatttaa

DBGET integrated database retrieval system