Schistosoma mansoni: Smp_077790 Help Entry Smp_077790        CDS       T01095                                  Name (RefSeq) putative histone H2B   KO K11252   histone H2B Organism smm  Schistosoma mansoni Brite KEGG Orthology (KO) [BR:smm00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:smm03036]     Smp_077790   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:smm04147]     Smp_077790 Chromosome and associated proteins [BR:smm03036]  Eukaryotic type   Nucleosome assembly factors    Histones     Smp_077790 Exosome [BR:smm04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Smp_077790 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  8345281 NCBI-ProteinID:  XP_018653467 UniProt:  G4VL73 LinkDB All DBs Position 6:19709750..19709998 Genome browser AA seq 82 aa AA seqDB search MPPKVVSGKAAKKASKVKLPKIDQNKKRRRKESYAIYIYKVLRQVHPDTGISSKAKSIMN SFVNDIFKRIAAEASRLSHYNK NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcctcctaaagttgtgtctggtaaagctgcgaagaaagcctcgaaggttaagctgccg aagattgatcagaataagaagagaaggaggaaggagagttatgctatctacatctataaa gttcttcgtcaagttcatcctgacactggtatctcgtcgaaggcaaagtcaatcatgaac tcgtttgtgaacgatatctttaagcgcattgccgcagaagccagccgactatcgcactac aacaagtag

DBGET integrated database retrieval system